RegulonDB RegulonDB 10.9: Gene Form
   

torR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

torS torC torT torR TorR TorR TorR TorR terminator torCp torCp torRp torRp torTp2 torTp2 torTp1 torTp1 torTp7 torTp7 torSp5 torSp5

Gene      
Name: torR    Texpresso search in the literature
Synonym(s): ECK0986, EG12615, b0995
Genome position(nucleotides): 1057262 <-- 1057954 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.38
External database links:  
ASAP:
ABE-0003362
CGSC:
36408
ECHOBASE:
EB2499
ECOLIHUB:
torR
OU-MICROARRAY:
b0995
STRING:
511145.b0995
COLOMBOS: torR


Product      
Name: DNA-binding transcriptional dual regulator TorR
Synonym(s): TorR, TorR response regulator
Sequence: Get amino acid sequence Fasta Format
Regulator Family: OmpR
Cellular location: cytosol
Molecular weight: 26.233
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
132 -> 227 DNCYRFAGYCLNVSRHTLERDGEPIKLTRAEYEMLVAFVTNPGEILSRERLLRMLSARRVENPDLRTVDVLIRRLRHKLSADLLVTQHGEGYFLAA
4 -> 117 HIVIVEDEPVTQARLQSYFTQEGYTVSVTASGAGLREIMQNQSVDLILLDINLPDENGLMLTRALRERSTVGIILVTGRSDRIDRIVGLEMGADDYVTKPLELRELVVRVKNLL
5 -> 113 IVIVEDEPVTQARLQSYFTQEGYTVSVTASGAGLREIMQNQSVDLILLDINLPDENGLMLTRALRERSTVGIILVTGRSDRIDRIVGLEMGADDYVTKPLELRELVVRV
153 -> 225 GEPIKLTRAEYEMLVAFVTNPGEILSRERLLRMLSARRVENPDLRTVDVLIRRLRHKLSADLLVTQHGEGYFL
53 -> 53 D

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000156 - phosphorelay response regulator activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
External database links:  
DIP:
DIP-11016N
ECOCYC:
TORR-MONOMER
ECOLIWIKI:
b0995
INTERPRO:
IPR001867
INTERPRO:
IPR039420
INTERPRO:
IPR036388
INTERPRO:
IPR011006
INTERPRO:
IPR001789
MODBASE:
P38684
PANTHER:
PTHR26402
PDB:
1ZGZ
PFAM:
PF00072
PFAM:
PF00486
PRIDE:
P38684
PRODB:
PRO_000024089
PROSITE:
PS50110
PROSITE:
PS51755
REFSEQ:
NP_415515
SMART:
SM00448
SMART:
SM00862
SMR:
P38684
UNIPROT:
P38684


Operon      
Name: torR         
Operon arrangement:
Transcription unit        Promoter
torR


Transcriptional Regulation      
Display Regulation             
Repressed by: TorR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter torSp5 1056182 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter torTp7 1056207 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter torTp1 1056220 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter torTp2 1056222 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB