RegulonDB RegulonDB 10.9: Gene Form
   

dppB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dppA dppB dppC IHF terminator TSS_4154 (cluster) TSS_4154 (cluster) TSS_4153 TSS_4153 TSS_4152 TSS_4152 TSS_4151 TSS_4151 TSS_4150 (cluster) TSS_4150 (cluster) TSS_4149 TSS_4149 TSS_4148 TSS_4148 TSS_4147 TSS_4147 TSS_4146 TSS_4146 TSS_4145 TSS_4145 TSS_4144 (cluster) TSS_4144 (cluster) TSS_4143 TSS_4143 TSS_4142 TSS_4142

Gene      
Name: dppB    Texpresso search in the literature
Synonym(s): ECK3530, EG12625, b3543
Genome position(nucleotides): 3704771 <-- 3705790 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.47
External database links:  
ASAP:
ABE-0011572
CGSC:
33771
ECHOBASE:
EB2509
ECOLIHUB:
dppB
OU-MICROARRAY:
b3543
STRING:
511145.b3543
COLOMBOS: dppB


Product      
Name: dipeptide ABC transporter membrane subunit DppB
Synonym(s): DppB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 37.497
Isoelectric point: 9.004
Motif(s):
 
Type Positions Sequence
114 -> 336 GIPVGVLAAVKRGSIFDHTAVGLALTGYSMPIFWWGMMLIMLVSVHWNLTPVSGRVSDMVFLDDSNPLTGFMLIDTAIWGEDGNFIDAVAHMILPAIVLGTIPLAVIVRMTRSSMLEVLGEDYIRTARAKGLTRMRVIIVHALRNAMLPVVTVIGLQVGTLLAGAILTETIFSWPGLGRWLIDALQRRDYPVVQGGVLLVATMIILVNLLVDLLYGVVNPRIR
10 -> 30 GLVIPTFIGITLLTFAFVHMI
172 -> 192 MVFLDDSNPLTGFMLIDTAIW
96 -> 328 FQATLELGVCAMIFATAVGIPVGVLAAVKRGSIFDHTAVGLALTGYSMPIFWWGMMLIMLVSVHWNLTPVSGRVSDMVFLDDSNPLTGFMLIDTAIWGEDGNFIDAVAHMILPAIVLGTIPLAVIVRMTRSSMLEVLGEDYIRTARAKGLTRMRVIIVHALRNAMLPVVTVIGLQVGTLLAGAILTETIFSWPGLGRWLIDALQRRDYPVVQGGVLLVATMIILVNLLVDLLY
136 -> 156 LALTGYSMPIFWWGMMLIMLV

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0055052 - ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
molecular_function GO:0071916 - dipeptide transmembrane transporter activity
biological_process GO:0015031 - protein transport
GO:0015833 - peptide transport
GO:0015886 - heme transport
GO:0055085 - transmembrane transport
GO:0035442 - dipeptide transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47927N
ECOCYC:
DPPB-MONOMER
ECOLIWIKI:
b3543
INTERPRO:
IPR000515
INTERPRO:
IPR035906
PFAM:
PF00528
PRIDE:
P0AEF8
PRODB:
PRO_000022474
PROSITE:
PS50928
REFSEQ:
NP_418000
UNIPROT:
P0AEF8


Operon      
Name: dppABCDF         
Operon arrangement:
Transcription unit        Promoter
dppABCDF


Transcriptional Regulation      
Display Regulation             
Activated by: IHF
Repressed by: FNR


RNA cis-regulatory element    
Attenuation: Translational


Regulation by small RNA    
  Display Regulation
small RNA spf


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4142 3704129 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4143 3704681 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4144 (cluster) 3704734 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4145 3704861 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4146 3704911 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4147 3706267 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4148 3706923 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4149 3706927 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4150 (cluster) 3707044 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4151 3707053 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4152 3707203 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4153 3707508 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4154 (cluster) 3707699 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB