RegulonDB RegulonDB 10.7: Gene Form
   

gntK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gntU gntR gntK CRP IdnR GntR IdnR GntR gntKp gntKp gntUp2 gntUp2

Gene      
Name: gntK    Texpresso search in the literature
Synonym(s): ECK3422, EG12629, b3437
Genome position(nucleotides): 3577065 <-- 3577592 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.62
Reference(s): [1] Tong S., et al., 1996
External database links:  
ASAP:
ABE-0011224
CGSC:
35465
ECHOBASE:
EB2513
OU-MICROARRAY:
b3437
PORTECO:
gntK
REGULONDB:
b3437
STRING:
511145.b3437
M3D: gntK
COLOMBOS: gntK
PortEco: b3437


Shine dalgarno      
Sequence: tcttgtattgTGGGGGcaccacTTT


Product      
Name: D-gluconate kinase, thermostable
Synonym(s): GntK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 19.543
Isoelectric point: 6.722
Motif(s):
 
Type Positions Sequence
15 -> 22 GVSGSGKS
17 -> 171 SGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRLKARKGHFFKTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVI
2 -> 175 STTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRLKARKGHFFKTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKKGK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.9 - misc. glucose metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0046316 - gluconokinase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0016310 - phosphorylation
GO:0046177 - D-gluconate catabolic process
External database links:  
DIP:
DIP-9820N
ECOCYC:
GLUCONOKINII-MONOMER
ECOLIWIKI:
b3437
INTERPRO:
IPR031322
INTERPRO:
IPR027417
INTERPRO:
IPR006001
MODBASE:
P46859
PDB:
1KOF
PDB:
1KO8
PDB:
1KO5
PDB:
1KO4
PDB:
1KO1
PDB:
1KNQ
PFAM:
PF01202
PRIDE:
P46859
PRODB:
PRO_000022825
PROTEINMODELPORTAL:
P46859
REFSEQ:
NP_417894
SMR:
P46859
UNIPROT:
P46859


Operon      
Name: gntRKU         
Operon arrangement:
Transcription unit        Promoter
gntK
gntKU
gntR
gntR
gntR
gntRKU
 


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: GntR, IdnR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter gntUp2 3577085 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Tong S., Porco A., Isturiz T., Conway T., 1996, Cloning and molecular genetic characterization of the Escherichia coli gntR, gntK, and gntU genes of GntI, the main system for gluconate metabolism., J Bacteriol 178(11):3260-9

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB