RegulonDB RegulonDB 10.7: Gene Form
   

gntR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gntR yhhW gntK CRP IdnR GntR IdnR GntR gntRp4 gntRp4 gntRp3 gntRp3 gntRp2 gntRp2 gntRp1 gntRp1 gntKp gntKp gntUp2 gntUp2

Gene      
Name: gntR    Texpresso search in the literature
Synonym(s): ECK3423, EG12630, b3438
Genome position(nucleotides): 3577731 <-- 3578726 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.42
External database links:  
ASAP:
ABE-0011226
CGSC:
667
ECHOBASE:
EB2514
OU-MICROARRAY:
b3438
PORTECO:
gntR
REGULONDB:
b3438
STRING:
511145.b3438
M3D: gntR
COLOMBOS: gntR
PortEco: b3438


Shine dalgarno      
Sequence: tttgtaccttCAGGACGAT


Product      
Name: DNA-binding transcriptional repressor GntR
Synonym(s): GntR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: GalR/LacI
Cellular location: cytosol
Molecular weight: 36.422
Isoelectric point: 6.883
Motif(s):
 
Type Positions Sequence
8 -> 52 LQDVADRVGVTKMTVSRFLRNPEQVSVALRGKIAAALDELGYIPN
6 -> 60 PVLQDVADRVGVTKMTVSRFLRNPEQVSVALRGKIAAALDELGYIPNRAPDILSN
64 -> 309 RAIGVLLPSLTNQVFAEVLRGIESVTDAHGYQTMLAHYGYKPEMEQERLESMLSWNIDGLILTERTHTPRTLKMIEVAGIPVVELMDSKSPCLDIAVGFDNFEAARQMTTAIIARGHRHIAYLGARLDERTIIKQKGYEQAMLDAGLVPYSVMVEQSSSYSSGIELIRQARREYPQLDGVFCTNDDLAVGAAFECQRLGLKVPDDMAIAGFHGHDIGQVMEPRLASVLTPRERMGSIGAERLLARI

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0006974 - cellular response to DNA damage stimulus
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0046177 - D-gluconate catabolic process
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Tong S., et al., 1996
[2] Zwaig N., et al., 1973
External database links:  
DIP:
DIP-9822N
ECOCYC:
PD03585
ECOLIWIKI:
b3438
INTERPRO:
IPR001761
INTERPRO:
IPR000843
INTERPRO:
IPR010982
INTERPRO:
IPR028082
MODBASE:
P0ACP5
PFAM:
PF00532
PFAM:
PF00356
PRIDE:
P0ACP5
PRODB:
PRO_000022826
PROSITE:
PS50932
PROSITE:
PS00356
PROTEINMODELPORTAL:
P0ACP5
REFSEQ:
YP_026222
SMART:
SM00354
SMR:
P0ACP5
UNIPROT:
P0ACP5


Operon      
Name: gntRKU         
Operon arrangement:
Transcription unit        Promoter
gntK
gntKU
gntR
gntR
gntR
gntRKU
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter gntUp2 3577085 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter gntRp1 3578749 reverse The gntRp promoter is constitutively
Read more >
[AIPP] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [AIPP] Automated inference of promoter position



Reference(s)    

 [1] Tong S., Porco A., Isturiz T., Conway T., 1996, Cloning and molecular genetic characterization of the Escherichia coli gntR, gntK, and gntU genes of GntI, the main system for gluconate metabolism., J Bacteriol 178(11):3260-9

 [2] Zwaig N., Nagel de Zwaig R., Isturiz T., Wecksler M., 1973, Regulatory mutations affecting the gluconate system in Escherichia coli., J Bacteriol 114(2):469-73

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Izu H., Adachi O., Yamada M., 1997, Gene organization and transcriptional regulation of the gntRKU operon involved in gluconate uptake and catabolism of Escherichia coli., J Mol Biol 267(4):778-93


RegulonDB