RegulonDB RegulonDB 10.6.3: Gene Form
   

qseC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

qseC qseB ygiW ygiZ QseB BasR QseB ygiWp5 ygiWp5 qseBp1 qseBp1 ygiWp6 ygiWp6 qseBp2 qseBp2 ygiWp7 ygiWp7 TSS_3326 (cluster) TSS_3326 (cluster) ygiVp3 ygiVp3 ygiVp2 ygiVp2

Gene      
Name: qseC    Texpresso search in the literature
Synonym(s): ECK3017, EG12658, b3026, ygiY
Genome position(nucleotides): 3170484 --> 3171833 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.04
External database links:  
ASAP:
ABE-0009938
ECHOBASE:
EB2845
ECOCYC:
EG12658
ECOLIHUB:
qseC
OU-MICROARRAY:
b3026
REGULONDB:
b3026
STRING:
511145.b3026
M3D: qseC
COLOMBOS: qseC
PortEco: b3026


Product      
Name: sensory histidine kinase QseC
Synonym(s): QseC, YgiY
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 50.282
Isoelectric point: 5.486
Motif(s):
 
Type Positions Sequence
13 -> 33 LTLIFLILASVTWLLSSFVAW
23 -> 158 VTWLLSSFVAWKQTTDNVDELFDTQLMLFAKRLSTLDLNEINAADRMAQTPNRLKHGHVDDDALTFAIFTHDGRMVLNDGDNGEDIPYSYQREGFADGQLVGEDDPWRFVWMTSPDGKYRIVVGQEWEYREDMALA
353 -> 444 LSLLVRNLLDNAVRYSPQGSVVDVTLNADNFIVRDNGPGVTPEALARIGERFYRPPGQTATGSGLGLSIVQRIAKLHGMNVEFGNAEQGGFE
238 -> 301 RRFTSDAAHELRSPLTALKVQTEVAQLSDDDPQARKKALLQLHSGIDRATRLVDQLLTLSRLDS
243 -> 449 DAAHELRSPLTALKVQTEVAQLSDDDPQARKKALLQLHSGIDRATRLVDQLLTLSRLDSLDNLQDVAEIPLEDLLQSSVMDIYHTAQQAKIDVRLTLNAHSIKRTGQPLLLSLLVRNLLDNAVRYSPQGSVVDVTLNADNFIVRDNGPGVTPEALARIGERFYRPPGQTATGSGLGLSIVQRIAKLHGMNVEFGNAEQGGFEAKVSW

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
biological_process GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0018106 - peptidyl-histidine phosphorylation
GO:0023014 - signal transduction by protein phosphorylation
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IEP] Inferred from expression pattern
Reference(s): [1] Sperandio V., et al., 2002
External database links:  
DISPROT:
DP00774
ECOCYC:
EG12658-MONOMER
ECOLIWIKI:
b3026
INTERPRO:
IPR004358
INTERPRO:
IPR036890
INTERPRO:
IPR036097
INTERPRO:
IPR013727
INTERPRO:
IPR005467
INTERPRO:
IPR003661
INTERPRO:
IPR003594
MODBASE:
P40719
PDB:
2KSE
PDB:
3JZ3
PFAM:
PF02518
PFAM:
PF00512
PFAM:
PF08521
PRIDE:
P40719
PRINTS:
PR00344
PRODB:
PRO_000023667
PROSITE:
PS50109
PROTEINMODELPORTAL:
P40719
REFSEQ:
NP_417498
SMART:
SM00387
SMART:
SM00388
SMR:
P40719
UNIPROT:
P40719


Operon      
Name: qseBC         
Operon arrangement:
Transcription unit        Promoter
qseBC
qseBC


Transcriptional Regulation      
Display Regulation             
Activated by: BasR, QseB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ygiVp2 3169287 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ygiVp3 3169291 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_3326 (cluster) 3169416 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter ygiWp7 3169688 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ygiWp6 3169749 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ygiWp5 3169887 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Sperandio V., Torres AG., Kaper JB., 2002, Quorum sensing Escherichia coli regulators B and C (QseBC): a novel two-component regulatory system involved in the regulation of flagella and motility by quorum sensing in E. coli., Mol Microbiol 43(3):809-21

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB