RegulonDB RegulonDB 10.8: Gene Form
   

gltJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gltJ gltL gltK sroC gltI anti-anti-terminator anti-terminator terminator rihAp3 rihAp3

Gene      
Name: gltJ    Texpresso search in the literature
Synonym(s): ECK0647, EG12661, b0654
Genome position(nucleotides): 685929 <-- 686669 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.5
External database links:  
ASAP:
ABE-0002239
ECHOBASE:
EB2527
OU-MICROARRAY:
b0654
PortEco:
gltJ
STRING:
511145.b0654
COLOMBOS: gltJ


Product      
Name: glutamate/aspartate ABC transporter membrane subunit GltJ
Synonym(s): GltJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 27.503
Isoelectric point: 9.37
Motif(s):
 
Type Positions Sequence
179 -> 196 LVKNSAIASTIGLVDMAA
33 -> 53 IALSICAWIIAFLVGSFFGIL
212 -> 232 FTAITLAYVLINAFIMLVMTL
29 -> 230 FQVTIALSICAWIIAFLVGSFFGILRTVPNRFLSGLGTLYVELFRNVPLIVQFFTWYLVIPELLPEKIGMWFKAELDPNIQFFLSSMLCLGLFTAARVCEQVRAAIQSLPRGQKNAALAMGLTLPQAYRYVLLPNAYRVIVPPMTSEMMNLVKNSAIASTIGLVDMAAQAGKLLDYSAHAWESFTAITLAYVLINAFIMLVM
104 -> 124 LDPNIQFFLSSMLCLGLFTAA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.1 - glutamate
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.5 - aspartate
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0022857 - transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0055085 - transmembrane transport
GO:0071705 - nitrogen compound transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-35965N
ECOCYC:
GLTJ-MONOMER
ECOLIWIKI:
b0654
INTERPRO:
IPR000515
INTERPRO:
IPR010065
INTERPRO:
IPR030202
INTERPRO:
IPR035906
MINT:
MINT-1264109
PANTHER:
PTHR30614:SF42
PFAM:
PF00528
PRIDE:
P0AER3
PRODB:
PRO_000022808
PROSITE:
PS50928
REFSEQ:
NP_415187
SMR:
P0AER3
UNIPROT:
P0AER3


Operon      
Name: gltI-sroC-gltJKL         
Operon arrangement:
Transcription unit        Promoter
gltIJKL-sroC
gltI-sroC-gltJKL


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rihAp3 684602 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB