RegulonDB RegulonDB 10.7: Gene Form
   

gltK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rihA gltJ gltL gltK sroC gltI anti-anti-terminator anti-terminator terminator rihAp3 rihAp3 TSS_777 (cluster) TSS_777 (cluster) hscCp7 hscCp7 hscCp5 hscCp5

Gene      
Name: gltK    Texpresso search in the literature
Synonym(s): ECK0646, EG12662, b0653
Genome position(nucleotides): 685255 <-- 685929 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.22
External database links:  
ASAP:
ABE-0002234
ECHOBASE:
EB2528
OU-MICROARRAY:
b0653
PORTECO:
gltK
REGULONDB:
b0653
STRING:
511145.b0653
M3D: gltK
COLOMBOS: gltK
PortEco: b0653


Product      
Name: glutamate/aspartate ABC transporter membrane subunit GltK
Synonym(s): GltK
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 24.915
Isoelectric point: 9.721
Motif(s):
 
Type Positions Sequence
68 -> 88 LVMVLLWFYLIVPGFLQNVLG
95 -> 112 IRLISAMVAFSMFEAAYY
155 -> 175 VPLLLTQGIVLFQDTSLVYVL
34 -> 223 GILWGTMLAVMRLSSFAPVAWFAKAYVNVFRSIPLVMVLLWFYLIVPGFLQNVLGLSPKNDIRLISAMVAFSMFEAAYYSEIIRAGIQSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADFFRTASTIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKRRT
197 -> 217 MILFAGFVYFVISLSASLLVS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.1 - glutamate
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.5 - aspartate
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0022857 - transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0055085 - transmembrane transport
GO:0071705 - nitrogen compound transport
GO:1901998 - toxin transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
GLTK-MONOMER
ECOLIWIKI:
b0653
INTERPRO:
IPR000515
INTERPRO:
IPR010065
INTERPRO:
IPR030205
INTERPRO:
IPR035906
PANTHER:
PTHR30614:SF1
PFAM:
PF00528
PRIDE:
P0AER5
PRODB:
PRO_000022809
PROSITE:
PS50928
PROTEINMODELPORTAL:
P0AER5
REFSEQ:
NP_415186
SMR:
P0AER5
UNIPROT:
P0AER5


Operon      
Name: gltI-sroC-gltJKL         
Operon arrangement:
Transcription unit        Promoter
gltIJKL-sroC
 


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter hscCp5 683482 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter hscCp7 683594 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_777 (cluster) 684440 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter rihAp3 684602 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB