RegulonDB RegulonDB 10.7: Gene Form
   

gltL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rihA gltJ gltL gltK rihAp3 rihAp3 TSS_777 (cluster) TSS_777 (cluster) hscCp7 hscCp7 hscCp5 hscCp5

Gene      
Name: gltL    Texpresso search in the literature
Synonym(s): ECK0645, EG12663, b0652
Genome position(nucleotides): 684530 <-- 685255 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.34
External database links:  
ASAP:
ABE-0002232
ECHOBASE:
EB2529
OU-MICROARRAY:
b0652
PORTECO:
gltL
REGULONDB:
b0652
STRING:
511145.b0652
M3D: gltL
COLOMBOS: gltL
PortEco: b0652


Product      
Name: glutamate/aspartate ABC transporter ATP binding subunit
Synonym(s): GltL
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 26.661
Isoelectric point: 7.132
Motif(s):
 
Type Positions Sequence
2 -> 236 ITLKNVSKWYGHFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIKTVNGLEPVQQGEITVDGIVVNDKKTDLAKLRSRVGMVFQHFELFPHLSIIENLTLAQVKVLKRDKAPAREKALKLLERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEPTSALDPEMINEVLDVMVELANEGMTMMVVTHEMGFARKVANRVIFMDEGKIVEDSPKDAFFDDPKSDRAKDFL
137 -> 140 LSGG
17 -> 165 LTDCSTEVKKGEVVVVCGPSGSGKSTLIKTVNGLEPVQQGEITVDGIVVNDKKTDLAKLRSRVGMVFQHFELFPHLSIIENLTLAQVKVLKRDKAPAREKALKLLERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEPTS
34 -> 41 GPSGSGKS
157 -> 164 AMLFDEPT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.1 - glutamate
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.5 - aspartate
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0015599 - ATPase-coupled L-glutamine transmembrane transporter activity
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015424 - ATPase-coupled amino acid transmembrane transporter activity
GO:0015426 - ATPase-coupled polar amino acid-transporter activity
biological_process GO:0006865 - amino acid transport
GO:0003333 - amino acid transmembrane transport
GO:0006868 - glutamine transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48246N
ECOCYC:
GLTL-MONOMER
ECOLIWIKI:
b0652
INTERPRO:
IPR030679
INTERPRO:
IPR017871
INTERPRO:
IPR027417
INTERPRO:
IPR003439
INTERPRO:
IPR003593
MINT:
MINT-1307893
MODBASE:
P0AAG3
PANTHER:
PTHR43166:SF5
PFAM:
PF00005
PRIDE:
P0AAG3
PRODB:
PRO_000022810
PROSITE:
PS50893
PROSITE:
PS00211
PROTEINMODELPORTAL:
P0AAG3
REFSEQ:
NP_415185
SMART:
SM00382
SMR:
P0AAG3
SWISSMODEL:
P0AAG3
UNIPROT:
P0AAG3


Operon      
Name: gltI-sroC-gltJKL         
Operon arrangement:
Transcription unit        Promoter
gltIJKL-sroC
 


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter hscCp5 683482 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter hscCp7 683594 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_777 (cluster) 684440 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter rihAp3 684602 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB