RegulonDB RegulonDB 10.7: Gene Form
   

rarA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rarA serS lolA TSS_1091 TSS_1091 TSS_1090 TSS_1090 TSS_1089 TSS_1089 TSS_1088 (cluster) TSS_1088 (cluster) TSS_1087 TSS_1087 TSS_1086 TSS_1086 TSS_1085 TSS_1085 serSp serSp TSS_1083 TSS_1083 TSS_1082 TSS_1082 TSS_1081 TSS_1081

Gene      
Name: rarA    Texpresso search in the literature
Synonym(s): ECK0883, EG12690, b0892, mgsA, ycaJ
Genome position(nucleotides): 937994 --> 939337 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.57
External database links:  
ASAP:
ABE-0003034
ECHOBASE:
EB2553
OU-MICROARRAY:
b0892
PORTECO:
rarA
REGULONDB:
b0892
STRING:
511145.b0892
M3D: rarA
COLOMBOS: rarA
PortEco: b0892


Product      
Name: recombination factor
Synonym(s): MgsA, RarA, YcaJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 49.626
Isoelectric point: 6.338
Motif(s):
 
Type Positions Sequence
57 -> 64 GPPGTGKT
268 -> 434 GSAPDAALYWYARIITAGGDPLYVARRCLAIASEDVGNADPRAMQVAIAAWDCFTRVGPAEGERAIAQAIVYLACAPKSNAVYTAFKAALADARERPDYDVPVHLRNAPTKLMKEMGYGQEYRYAHDEANAYAAGEVYFPPEIAQTRYYFPTNRGLEGKIGEKLAWL
53 -> 159 MILWGPPGTGKTTLAEVIARYANADVERISAVTSGVKEIREAIERARQNRNAGRRTILFVDEVHRFNKSQQDAFLPHIEDGTITFIGATTENPSFELNSALLSRARV
156 -> 156 R
188 -> 267 QDIVLPDETRRAIAELVNGDARRALNTLEMMADMAEVDDSGKRVLKPELLTEIAGERSARFDNKGDRFYDLISALHKSVR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
  2 - information transfer --> 2.1 - DNA related --> 2.1.3 - DNA recombination
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0030894 - replisome
molecular_function GO:0003677 - DNA binding
GO:0008047 - enzyme activator activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0006260 - DNA replication
GO:0006261 - DNA-dependent DNA replication
GO:0006310 - DNA recombination
GO:0006282 - regulation of DNA repair
GO:0043085 - positive regulation of catalytic activity
Note(s): Note(s): ...[more].
Evidence: [IGI] Inferred from genetic interaction
Reference(s): [1] Barre FX., et al., 2001
[2] Kumar A., et al., 2016
External database links:  
DIP:
DIP-48151N
ECOCYC:
EG12690-MONOMER
ECOLIWIKI:
b0892
INTERPRO:
IPR003593
INTERPRO:
IPR027417
INTERPRO:
IPR032423
INTERPRO:
IPR003959
INTERPRO:
IPR008921
INTERPRO:
IPR021886
MINT:
MINT-1224512
MODBASE:
P0AAZ4
PDB:
3PVS
PFAM:
PF16193
PFAM:
PF12002
PFAM:
PF00004
PRIDE:
P0AAZ4
PRODB:
PRO_000023678
PROTEINMODELPORTAL:
P0AAZ4
REFSEQ:
NP_415412
SMART:
SM00382
SMR:
P0AAZ4
UNIPROT:
P0AAZ4


Operon      
Name: lolA-rarA         
Operon arrangement:
Transcription unit        Promoter
 


Transcriptional Regulation      
Display Regulation             
Activated by: RcsB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1081 937877 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1082 937932 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1083 939353 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1085 939422 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1086 939441 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1087 939732 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1088 (cluster) 939778 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_1089 939783 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1090 940085 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1091 940406 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Barre FX., Soballe B., Michel B., Aroyo M., Robertson M., Sherratt D., 2001, Circles: the replication-recombination-chromosome segregation connection., Proc Natl Acad Sci U S A 98(15):8189-95

 [2] Kumar A., Beloglazova N., Bundalovic-Torma C., Phanse S., Deineko V., Gagarinova A., Musso G., Vlasblom J., Lemak S., Hooshyar M., Minic Z., Wagih O., Mosca R., Aloy P., Golshani A., Parkinson J., Emili A., Yakunin AF., Babu M., 2016, Conditional Epistatic Interaction Maps Reveal Global Functional Rewiring of Genome Integrity Pathways in Escherichia coli., Cell Rep 14(3):648-61

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB