RegulonDB RegulonDB 10.8: Gene Form
   

hcxA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybdL hcxA ybdD ybdLp3 ybdLp3 ybdHp7 ybdHp7 ybdHp6 ybdHp6

Gene      
Name: hcxA    Texpresso search in the literature
Synonym(s): ECK0593, EG12692, b0599, ybdH
Genome position(nucleotides): 632389 <-- 633477 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.19
External database links:  
ASAP:
ABE-0002065
ECHOBASE:
EB2555
OU-MICROARRAY:
b0599
PortEco:
ybdH
STRING:
511145.b0599
COLOMBOS: hcxA


Product      
Name: hydroxycarboxylate dehydrogenase A
Synonym(s): HcxA, YbdH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.092
Isoelectric point: 6.033
Motif(s):
 
Type Positions Sequence
12 -> 348 PANYFSHPGSFNHLHDFFTDEQLSRAVWIYGKRAIAAAQTKLPPAFGLPGAKHILFRGHCSESDVQQLAAESGDDRSVVIGVGGGALLDTAKALARRLGLPFVAVPTIAATCAAWTPLSVWYNDAGQALHYEIFDDANFMVLVEPEIILNAPQQYLLAGIGDTLAKWYEAVVLAPQPETLPLTVRLGINNAQAIRDVLLNSSEQALSDQQNQQLTQSFCDVVDAIIAGGGMVGGLGDRFTRVAAAHAVHNGLTVLPQTEKFLHGTKVAYGILVQSALLGQDDVLAQLTGAYQRFHLPTTLAELEVDINNQAEIDKVIAHTLRPVESIHYLPVTLTPD

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0016614 - oxidoreductase activity, acting on CH-OH group of donors
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0047545 - 2-hydroxyglutarate dehydrogenase activity
GO:0042802 - identical protein binding
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11347N
ECOCYC:
EG12692-MONOMER
ECOLIWIKI:
b0599
INTERPRO:
IPR001670
INTERPRO:
IPR018211
INTERPRO:
IPR016205
MINT:
MINT-1302765
MODBASE:
P45579
PANTHER:
PTHR43616
PFAM:
PF00465
PRIDE:
P45579
PROSITE:
PS00913
REFSEQ:
NP_415132
SMR:
P45579
UNIPROT:
P45579


Operon      
Name: hcxA         
Operon arrangement:
Transcription unit        Promoter
ybdH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybdHp6 633517 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybdHp7 633524 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybdLp3 633557 forward Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [1], [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB