RegulonDB RegulonDB 10.8: Gene Form
   

nudL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sdaA pabB nudL TSS_2139 TSS_2139 sdaAp sdaAp TSS_2138 TSS_2138 TSS_2137 TSS_2137 yoaHp1 yoaHp1

Gene      
Name: nudL    Texpresso search in the literature
Synonym(s): ECK1811, EG12693, b1813, yeaB
Genome position(nucleotides): 1896170 --> 1896748 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.92
External database links:  
ASAP:
ABE-0006035
ECHOBASE:
EB2556
OU-MICROARRAY:
b1813
PortEco:
nudL
STRING:
511145.b1813
COLOMBOS: nudL


Product      
Name: putative NUDIX hydrolase with low 3-phosphohydroxypyruvate phosphatase activity
Synonym(s): NudL, YeaB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.436
Isoelectric point: 6.237
Motif(s):
 
Type Positions Sequence
30 -> 143 RQAAVLIPIVRRPQPGLLLTQRSIHLRKHAGQVAFPGGAVDDTDASAIAAALREAEEEVAIPPSAVEVIGVLPPVDSVTGYQVTPVVGIIPPDLPYRASEDEVSAVFEMPLAQA
29 -> 160 HRQAAVLIPIVRRPQPGLLLTQRSIHLRKHAGQVAFPGGAVDDTDASAIAAALREAEEEVAIPPSAVEVIGVLPPVDSVTGYQVTPVVGIIPPDLPYRASEDEVSAVFEMPLAQALHLGRYHPLDIYRRGDS
67 -> 89 GAVDDTDASAIAAALREAEEEVA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.6 - pyridoxal 5'phosphate
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0016818 - hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0046872 - metal ion binding
GO:0000287 - magnesium ion binding
GO:0030145 - manganese ion binding
biological_process GO:0009132 - nucleoside diphosphate metabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11783N
ECOCYC:
EG12693-MONOMER
ECOLIWIKI:
b1813
INTERPRO:
IPR023735
INTERPRO:
IPR015797
INTERPRO:
IPR000086
INTERPRO:
IPR000059
MINT:
MINT-1232423
MODBASE:
P43337
PFAM:
PF00293
PRIDE:
P43337
PROSITE:
PS01293
PROSITE:
PS51462
REFSEQ:
NP_416327
SMR:
P43337
SWISSMODEL:
P43337
UNIPROT:
P43337


Operon      
Name: pabB-nudL         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yoaHp1 1894933 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2137 1896141 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2138 1896143 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2139 1896882 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB