RegulonDB RegulonDB 10.9: Gene Form
   

yggN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ansB yggN yggL Fis CRP Fis FNR anti-anti-terminator anti-terminator terminator yggNp1 yggNp1 yggNp2 yggNp2 yggNp2b yggNp2b TSS_3283 TSS_3283 ansBp1 ansBp1 ansBp2 ansBp2 yggMp1 yggMp1

Gene      
Name: yggN    Texpresso search in the literature
Synonym(s): ECK2953, EG12705, b2958, ecfF
Genome position(nucleotides): 3100904 <-- 3101623 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.5
Reference(s): [1] Dartigalongue C., et al., 2001
External database links:  
ASAP:
ABE-0009706
ECHOBASE:
EB2567
ECOLIHUB:
yggN
OU-MICROARRAY:
b2958
STRING:
511145.b2958
COLOMBOS: yggN


Product      
Name: DUF2884 domain-containing protein YggN
Synonym(s): EcfF, YggN
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 26.429
Isoelectric point: 9.341
Motif(s):
 
Type Positions Sequence
24 -> 235 CSVTPRDDVIVSPQTVQVKGENGNLVITPDGNVMYNGKQYSLNAAQREQAKDYQAELRSTLPWIDEGAKSRVEKARIALDKIIVQEMGESSKMRSRLTKLDAQLKEQMNRIIETRSDGLTFHYKAIDQVRAEGQQLVNQAMGGILQDSINEMGAKAVLKSGGNPLQNVLGSLGGLQSSIQTEWKKQEKDFQQFGKDVCSRVVTLEDSRKALV
195 -> 195 L

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
biological_process GO:0044010 - single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [2] Beloin C., et al., 2004
External database links:  
ECOCYC:
EG12705-MONOMER
ECOLIWIKI:
b2958
INTERPRO:
IPR021307
PFAM:
PF11101
PRIDE:
P0ADS9
REFSEQ:
NP_417433
UNIPROT:
P0ADS9


Operon      
Name: yggN         
Operon arrangement:
Transcription unit        Promoter
yggN
yggN
yggN


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yggMp1 3099757 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_3283 3101055 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Dartigalongue C., Missiakas D., Raina S., 2001, Characterization of the Escherichia coli sigma E regulon., J Biol Chem 276(24):20866-75

 [2] Beloin C., Valle J., Latour-Lambert P., Faure P., Kzreminski M., Balestrino D., Haagensen JA., Molin S., Prensier G., Arbeille B., Ghigo JM., 2004, Global impact of mature biofilm lifestyle on Escherichia coli K-12 gene expression., Mol Microbiol 51(3):659-74

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB