RegulonDB RegulonDB 10.7: Gene Form
   

ybcI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cysS ybcI ybcJ anti-terminator terminator ybcIp5 ybcIp5

Gene      
Name: ybcI    Texpresso search in the literature
Synonym(s): ECK0520, EG12708, b0527
Genome position(nucleotides): 556032 <-- 556553 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.07
External database links:  
ASAP:
ABE-0001812
ECHOBASE:
EB2570
OU-MICROARRAY:
b0527
PORTECO:
ybcI
REGULONDB:
b0527
STRING:
511145.b0527
M3D: ybcI
COLOMBOS: ybcI
PortEco: b0527


Product      
Name: PF04307 family inner membrane protein YbcI
Synonym(s): YbcI
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 19.53
Isoelectric point: 10.877
Motif(s):
 
Type Positions Sequence
13 -> 35 CIGLGLGSKVIPPRLLFAGIILA
55 -> 77 FGHRGFTHSLVFAFVVPLLCVFI
148 -> 170 QVIISELMWVWLPGMLLMGMLWW
1 -> 166 MPTVITHAAVPLCIGLGLGSKVIPPRLLFAGIILAMLPDADVLSFKFGVAYGNVFGHRGFTHSLVFAFVVPLLCVFIGRRWFRAGLIRCWLFLTVSLLSHSLLDSVTTGGKGVGWLWPWSDERFFAPWQVIKVAPFALSRYTTPYGHQVIISELMWVWLPGMLLMG
84 -> 103 AGLIRCWLFLTVSLLSHSLL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12708-MONOMER
ECOLIWIKI:
b0527
INTERPRO:
IPR007404
PFAM:
PF04307
PRIDE:
P45570
PROTEINMODELPORTAL:
P45570
REFSEQ:
NP_415060
UNIPROT:
P45570


Operon      
Name: ybcI         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybcIp5 556632 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB