RegulonDB RegulonDB 10.8: Gene Form
   

yedI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yedA yedI yodC vsr yedIp2 yedIp2 TSS_2275 TSS_2275 TSS_2274 (cluster) TSS_2274 (cluster) yedIp3 yedIp3 yodCp6 yodCp6 yodCp7 yodCp7 TSS_2273 TSS_2273

Gene      
Name: yedI    Texpresso search in the literature
Synonym(s): ECK1956, EG12709, b1958
Genome position(nucleotides): 2028449 <-- 2029366 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.05
External database links:  
ASAP:
ABE-0006500
ECHOBASE:
EB2571
OU-MICROARRAY:
b1958
PortEco:
yedI
STRING:
511145.b1958
COLOMBOS: yedI


Product      
Name: DUF808 domain-containing inner membrane protein YedI
Synonym(s): YedI
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 32.191
Isoelectric point: 8.492
Motif(s):
 
Type Positions Sequence
72 -> 92 VILVPLALIISAFIPWAITPL
6 -> 291 SSLLTLLDDIATLLDDISVMGKLAAKKTAGVLGDDLSLNAQQVSGVRANRELPVVWGVAKGSLINKVILVPLALIISAFIPWAITPLLMIGGAFLCFEGVEKVLHMLEARKHKEDPAQSQQRLEKLAAQDPLKFEKDKIKGAIRTDFILSAEIVAITLGIVAEAPLLNQVLVLSGIALVVTVGVYGLVGVIVKIDDLGYWLAEKSSALMQALGKGLLIIAPWLMKALSIVGTLAMFLVGGGIVVHGIAPLHHAIEHFAGQQSAVVAMILPTVLNLILGFIIGGIVV
93 -> 113 LMIGGAFLCFEGVEKVLHMLE
272 -> 292 MILPTVLNLILGFIIGGIVVL
152 -> 172 FILSAEIVAITLGIVAEAPLL

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12709-MONOMER
ECOLIWIKI:
b1958
INTERPRO:
IPR008526
PANTHER:
PTHR30503
PFAM:
PF05661
PRIDE:
P46125
REFSEQ:
NP_416467
UNIPROT:
P46125


Operon      
Name: yedI         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2273 2028396 reverse nd [RS-EPT-CBR] [1]
  promoter yodCp7 2028410 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yodCp6 2028504 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yedIp3 2029370 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2274 (cluster) 2029390 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2275 2029392 reverse nd [RS-EPT-CBR] [1]
  promoter yedIp2 2029461 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB