RegulonDB RegulonDB 10.6.3: Gene Form
   

uxaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uxaA uxaC ygjV ygjVp4 ygjVp4

Gene      
Name: uxaA    Texpresso search in the literature
Synonym(s): ECK3082, EG12734, b3091, ygjW
Genome position(nucleotides): 3241827 <-- 3243314 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.7
External database links:  
ASAP:
ABE-0010164
CGSC:
17
ECHOBASE:
EB2592
ECOCYC:
EG12734
ECOLIHUB:
uxaA
OU-MICROARRAY:
b3091
REGULONDB:
b3091
STRING:
511145.b3091
M3D: uxaA
COLOMBOS: uxaA
PortEco: b3091


Product      
Name: D-altronate dehydratase
Synonym(s): UxaA, YgjW
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 54.093
Isoelectric point: 5.308
Motif(s):
 
Type Positions Sequence
107 -> 494 EVQIYRRANGDVGVRNELWILPTVGCVNGIARQIQNRFLKETNNAEGTDGVFLFSHTYGCSQLGDDHINTRTMLQNMVRHPNAGAVLVIGLGCENNQVAAFRETLGDIDPERVHFMICQQQDDEIEAGIEHLHQLYNVMRNDKREPGKLSELKFGLECGGSDGLSGITANPMLGRFSDYVIANGGTTVLTEVPEMFGAEQLLMDHCRDEATFEKLVTMVNDFKQYFIAHDQPIYENPSPGNKAGGITTLEDKSLGCTQKAGSSVVVDVLRYGERLKTPGLNLLSAPGNDAVATSALAGAGCHMVLFSTGRGTPYGGFVPTVKIATNSELAAKKKHWIDFDAGQLIHGKAMPQLLEEFIDTIVEFANGKQTCNERNDFRELAIFKSGVT
10 -> 81 DNVAVALADLAEGTEVSVDNQTVTLRQDVARGHKFALTDIAKGANVIKYGLPIGYALADIAAGVHVHAHNTR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016829 - lyase activity
GO:0008789 - altronate dehydratase activity
GO:0008198 - ferrous iron binding
biological_process GO:0019698 - D-galacturonate catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11105N
ECOCYC:
ALTRODEHYDRAT-MONOMER
ECOLIWIKI:
b3091
INTERPRO:
IPR007392
INTERPRO:
IPR013974
PFAM:
PF04295
PFAM:
PF08666
PRIDE:
P42604
PRODB:
PRO_000024203
PROTEINMODELPORTAL:
P42604
REFSEQ:
NP_417562
SMART:
SM00858
SMR:
P42604
UNIPROT:
P42604


Operon      
Name: uxaCA         
Operon arrangement:
Transcription unit        Promoter
uxaCA
uxaCA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FNR
Repressed by: ExuR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ygjVp4 3241819 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB