RegulonDB RegulonDB 10.9: Gene Form
   

agaB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

kbaY agaC agaB agaD

Gene      
Name: agaB    Texpresso search in the literature
Synonym(s): ECK3126, EG12769, b3138, yraD
Genome position(nucleotides): 3284170 --> 3284646 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.03
External database links:  
ASAP:
ABE-0010310
ECHOBASE:
EB2622
ECOLIHUB:
agaB
OU-MICROARRAY:
b3138
STRING:
511145.b3138
COLOMBOS: agaB


Product      
Name: galactosamine-specific PTS enzyme IIB component
Synonym(s): AgaB, YraD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.622
Isoelectric point: 6.795
Motif(s):
 
Type Positions Sequence
6 -> 153 ILLTRIDNRLVHGQVGVTWTSTIGANLLVVVDDVVANDDIQQKLMGITAETYGFGIRFFTIEKTINVIGKAAPHQKIFLICRTPQTVRKLVEGGIDLKDVNVGNMHFSEGKKQISSKVYVDDQDLTDLRFIKQRGVNVFIQDVPGDQK
1 -> 158 MTSPNILLTRIDNRLVHGQVGVTWTSTIGANLLVVVDDVVANDDIQQKLMGITAETYGFGIRFFTIEKTINVIGKAAPHQKIFLICRTPQTVRKLVEGGIDLKDVNVGNMHFSEGKKQISSKVYVDDQDLTDLRFIKQRGVNVFIQDVPGDQKEQIPD

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0034219 - carbohydrate transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Reizer J., et al., 1996
External database links:  
ECOCYC:
AGAB-MONOMER
ECOLIWIKI:
b3138
INTERPRO:
IPR018455
INTERPRO:
IPR036667
INTERPRO:
IPR004720
MODBASE:
P42909
PFAM:
PF03830
PRIDE:
P42909
PRODB:
PRO_000022065
PROSITE:
PS51101
REFSEQ:
NP_417607
SMR:
P42909
UNIPROT:
P42909


Operon      
Name: agaS-kbaY-agaBCDI         
Operon arrangement:
Transcription unit        Promoter
agaSYBCDI


Transcriptional Regulation      
Display Regulation             
Repressed by: AgaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Reizer J., Ramseier TM., Reizer A., Charbit A., Saier MH., 1996, Novel phosphotransferase genes revealed by bacterial genome sequencing: a gene cluster encoding a putative N-acetylgalactosamine metabolic pathway in Escherichia coli., Microbiology 142 ( Pt 2):231-50


RegulonDB