RegulonDB RegulonDB 10.7: Gene Form
   

ybaM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mscK priC ybaM ybaNp1 ybaNp1 ybaMp3 ybaMp3 TSS_631 TSS_631 TSS_630 TSS_630 TSS_629 TSS_629

Gene      
Name: ybaM    Texpresso search in the literature
Synonym(s): ECK0460, EG12830, b0466
Genome position(nucleotides): 490110 <-- 490271 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.15
External database links:  
ASAP:
ABE-0001616
ECHOBASE:
EB2679
OU-MICROARRAY:
b0466
PORTECO:
ybaM
REGULONDB:
b0466
STRING:
511145.b0466
M3D: ybaM
COLOMBOS: ybaM
PortEco: b0466


Product      
Name: DUF2496 domain-containing protein YbaM
Synonym(s): YbaM, small protein involved in the cell envelope stress response
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 6.025
Isoelectric point: 4.228
Motif(s):
 
Type Positions Sequence
2 -> 44 SLENAPDDVKLAVDLIVLLEENQIPASTVLRALDIVKRDYEKK

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0036460 - cellular response to cell envelope stress
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Hobbs EC., et al., 2010
External database links:  
ECOCYC:
EG12830-MONOMER
ECOLIWIKI:
b0466
INTERPRO:
IPR019630
PFAM:
PF10689
PRIDE:
P45807
PROTEINMODELPORTAL:
P45807
REFSEQ:
NP_414999
SMR:
P45807
UNIPROT:
P45807


Operon      
Name: priC-ybaM         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_629 487911 forward nd [RS-EPT-CBR] [2]
  promoter TSS_630 488317 forward nd [RS-EPT-CBR] [2]
  promoter TSS_631 489636 forward nd [RS-EPT-CBR] [2]
  promoter ybaMp3 490324 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ybaNp1 490718 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Hobbs EC., Astarita JL., Storz G., 2010, Small RNAs and small proteins involved in resistance to cell envelope stress and acid shock in Escherichia coli: analysis of a bar-coded mutant collection., J Bacteriol 192(1):59-67

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB