RegulonDB RegulonDB 10.9: Gene Form
   

yhdY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yhdX yhdY yhdZ

Gene      
Name: yhdY    Texpresso search in the literature
Synonym(s): ECK3257, EG12836, b3270
Genome position(nucleotides): 3421325 --> 3422428 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.45
External database links:  
ASAP:
ABE-0010736
ECHOBASE:
EB2685
ECOLIHUB:
yhdY
OU-MICROARRAY:
b3270
STRING:
511145.b3270
COLOMBOS: yhdY


Product      
Name: putative ABC transporter membrane subunit YhdY
Synonym(s): YhdY
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 41.484
Isoelectric point: 10.131
Motif(s):
 
Type Positions Sequence
37 -> 57 LTIGCIWLMWELIPPLLNWAF
174 -> 360 LPWGILLALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALFKDTSLVIIIGLFDLFSSVQQATVDPAWLGMSTEGYVFAALIYWIFCFSMSRYSQYLEKRF
292 -> 312 LVNTIIALFKDTSLVIIIGLF
100 -> 120 INLALLIGLVSIAPMFWKILP
193 -> 213 ILSVIFIEFWRGVPLITVLFM

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0022857 - transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0055085 - transmembrane transport
GO:0071705 - nitrogen compound transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
DIP:
DIP-12306N
ECOCYC:
YHDY-MONOMER
ECOLIWIKI:
b3270
INTERPRO:
IPR043429
INTERPRO:
IPR010065
INTERPRO:
IPR000515
INTERPRO:
IPR035906
PANTHER:
PTHR30614
PFAM:
PF00528
PRIDE:
P45768
PROSITE:
PS50928
REFSEQ:
NP_417736
UNIPROT:
P45768


Operon      
Name: yhdWXYZ         
Operon arrangement:
Transcription unit        Promoter
yhdWXYZ


Transcriptional Regulation      
Display Regulation             
Activated by: NtrC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195


RegulonDB