RegulonDB RegulonDB 10.7: Gene Form
   

ybjC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rimK nfsA ybjC grxA SoxS Rob MarA OxyR SoxS OxyR OxyR rimKp rimKp ybjCp ybjCp grxAp grxAp

Gene      
Name: ybjC    Texpresso search in the literature
Synonym(s): ECK0841, EG12842, b0850
Genome position(nucleotides): 890913 --> 891200 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.35
External database links:  
ASAP:
ABE-0002898
ECHOBASE:
EB2691
OU-MICROARRAY:
b0850
PORTECO:
ybjC
REGULONDB:
b0850
STRING:
511145.b0850
M3D: ybjC
COLOMBOS: ybjC
PortEco: b0850


Product      
Name: DUF1418 domain-containing protein YbjC
Synonym(s): YbjC
Sequence: Get amino acid sequence Fasta Format
Cellular location: membrane
Molecular weight: 10.521
Isoelectric point: 10.014
Motif(s):
 
Type Positions Sequence
1 -> 92 MRAIGKLPKGVLILEFIGMMLLAVALLSVSDSLSLPEPFSRPEVQILMIFLGVLLMLPAAVVVILQVAKRLAPQLMNRPPQYSRSEREKDND

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
biological_process GO:1901422 - response to butan-1-ol
GO:1901562 - response to paraquat
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12842-MONOMER
ECOLIWIKI:
b0850
INTERPRO:
IPR010815
PFAM:
PF07214
PRIDE:
P46119
PROTEINMODELPORTAL:
P46119
REFSEQ:
NP_415371
UNIPROT:
P46119


Operon      
Name: ybjC-nfsA-rimK-ybjN         
Operon arrangement:
Transcription unit        Promoter
ybjC-nfsA-rimK-ybjN
rimK-ybjN
ybjN


Transcriptional Regulation      
Display Regulation             
Activated by: MarA, SoxS, Rob
Repressed by: OxyR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB