RegulonDB RegulonDB 10.7: Gene Form
   

cpoB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cpoB pal lysT Fis Cis-reg lysTp lysTp TSS_896 TSS_896

Gene      
Name: cpoB    Texpresso search in the literature
Synonym(s): ECK0731, EG12854, b0742, ybgF
Genome position(nucleotides): 779598 --> 780389 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.49
External database links:  
ASAP:
ABE-0002523
ECHOBASE:
EB2698
OU-MICROARRAY:
b0742
PORTECO:
ybgF
REGULONDB:
b0742
STRING:
511145.b0742
M3D: cpoB
COLOMBOS: cpoB
PortEco: b0742


Product      
Name: cell division coordinator CpoB
Synonym(s): CpoB, YbgF
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 28.231
Isoelectric point: 9.077
Motif(s):
 
Type Positions Sequence
173 -> 173 Y
218 -> 250 DAMFKVGVIMQDKGDTAKAKAVYQQVISKYPGT
159 -> 214 QDDAMVAFQNFIKNYPDSTYLPNANYWLGQLNYNKGKKDDAAYYFASVVKNYPKSP
1 -> 26 MSSNFRHQLLSLSLLVGIAAPWAAFA
27 -> 263 QAPISSVGSGSVEDRVTQLERISNAHSQLLTQLQQQLSDNQSDIDSLRGQIQENQYQLNQVVERQKQILLQIDSLSSGGAAAQSTSGDQSGAAASTTPTADAGTANAGAPVKSGNANTDYNAAIALVQDKSRQDDAMVAFQNFIKNYPDSTYLPNANYWLGQLNYNKGKKDDAAYYFASVVKNYPKSPKAADAMFKVGVIMQDKGDTAKAKAVYQQVISKYPGTDGAKQAQKRLNAM

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0032991 - protein-containing complex
molecular_function GO:0005515 - protein binding
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0043093 - FtsZ-dependent cytokinesis
GO:0070206 - protein trimerization
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
[IGI] Inferred from genetic interaction
[IPI] Inferred from physical interaction
Reference(s): [1] Gray AN., et al., 2015
[2] Monton Silva A., et al., 2018
[3] Walburger A., et al., 2002
External database links:  
DIP:
DIP-11392N
ECOCYC:
EG12854-MONOMER
ECOLIWIKI:
b0742
INTERPRO:
IPR011990
INTERPRO:
IPR013026
INTERPRO:
IPR032519
INTERPRO:
IPR014162
INTERPRO:
IPR034706
INTERPRO:
IPR019734
MINT:
MINT-1224573
MODBASE:
P45955
PDB:
6G5S
PDB:
2XDJ
PDB:
2WZ7
PFAM:
PF13174
PFAM:
PF16331
PRIDE:
P45955
PROSITE:
PS50293
PROTEINMODELPORTAL:
P45955
REFSEQ:
NP_415270
SMR:
P45955
UNIPROT:
P45955


Operon      
Name: tolB-pal-cpoB         
Operon arrangement:
Transcription unit        Promoter
tolB-pal-ybgF
 


RNA cis-regulatory element    
   
Cis-reg RtT RNA
   
   


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_896 779365 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gray AN., Egan AJ., Van't Veer IL., Verheul J., Colavin A., Koumoutsi A., Biboy J., Altelaar AF., Damen MJ., Huang KC., Simorre JP., Breukink E., den Blaauwen T., Typas A., Gross CA., Vollmer W., 2015, Coordination of peptidoglycan synthesis and outer membrane constriction during Escherichia coli cell division., Elife 4

 [2] Monton Silva A., Otten C., Biboy J., Breukink E., VanNieuwenhze M., Vollmer W., den Blaauwen T., 2018, The Fluorescent D-Amino Acid NADA as a Tool to Study the Conditional Activity of Transpeptidases in Escherichia coli., Front Microbiol 9:2101

 [3] Walburger A., Lazdunski C., Corda Y., 2002, The Tol/Pal system function requires an interaction between the C-terminal domain of TolA and the N-terminal domain of TolB., Mol Microbiol 44(3):695-708

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB