RegulonDB RegulonDB 10.8: Gene Form
   

matP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycbZ ompA matP FadR TSS_1279 TSS_1279 TSS_1278 TSS_1278 TSS_1277 TSS_1277 TSS_1276 TSS_1276 TSS_1275 TSS_1275 TSS_1274 TSS_1274 TSS_1273 TSS_1273 TSS_1272 TSS_1272 TSS_1271 TSS_1271 TSS_1270 TSS_1270 TSS_1269 TSS_1269 TSS_1268 TSS_1268 TSS_1267 TSS_1267 TSS_1266 TSS_1266 TSS_1265 TSS_1265 TSS_1264 TSS_1264 TSS_1263 TSS_1263 TSS_1262 TSS_1262 TSS_1261 TSS_1261 ycbZp4 ycbZp4 matPp matPp TSS_1259 (cluster) TSS_1259 (cluster) TSS_1258 TSS_1258 TSS_1257 TSS_1257 TSS_1256 TSS_1256 TSS_1255 (cluster) TSS_1255 (cluster) TSS_1254 TSS_1254 TSS_1253 TSS_1253 TSS_1252 TSS_1252

Gene      
Name: matP    Texpresso search in the literature
Synonym(s): ECK0947, EG12855, b0956, ycbG
Genome position(nucleotides): 1018485 --> 1018937 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.14
External database links:  
ASAP:
ABE-0003238
ECHOBASE:
EB2699
OU-MICROARRAY:
b0956
PortEco:
matP
STRING:
511145.b0956
COLOMBOS: matP


Product      
Name: macrodomain Ter protein
Synonym(s): MatP, YcbG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.693
Isoelectric point: 10.145
Motif(s):
 
Type Positions Sequence
2 -> 85 KYQQLENLESGWKWKYLVKKHREGELITRYIEASAAQEAVDVLLSLENEPVLVNGWIDKHMNPELVNRMKQTIRARRKRHFNAE
88 -> 147 HTRKKSIDLEFIVWQRLAGLAQRRGKTLSETIVQLIEDAENKEKYANKMSSLKQDLQALL

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0097047 - DNA replication termination region
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0043565 - sequence-specific DNA binding
GO:0042803 - protein homodimerization activity
biological_process GO:0051301 - cell division
GO:0006355 - regulation of transcription, DNA-templated
GO:0007049 - cell cycle
GO:0051276 - chromosome organization
GO:0007059 - chromosome segregation
Note(s): Note(s): ...[more].
Reference(s): [1] Buss J., et al., 2013
[2] Cagliero C., et al., 2013
[3] Lesterlin C., et al., 2012
[4] Mercier R., et al., 2009
[5] Thiel A., et al., 2012
External database links:  
ECOCYC:
EG12855-MONOMER
ECOLIWIKI:
b0956
INTERPRO:
IPR009390
INTERPRO:
IPR038339
INTERPRO:
IPR035375
INTERPRO:
IPR013321
INTERPRO:
IPR035087
PDB:
4D8J
PFAM:
PF06303
PFAM:
PF17414
PRIDE:
P0A8N0
PRODOM:
PD033720
REFSEQ:
NP_415476
SMR:
P0A8N0
UNIPROT:
P0A8N0


Operon      
Name: matP         
Operon arrangement:
Transcription unit        Promoter
matP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1252 1016859 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1253 1017045 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1254 1017052 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1255 (cluster) 1017834 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [6]
  promoter TSS_1256 1017837 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1257 1017843 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1258 1018324 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1259 (cluster) 1018330 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [6]
  promoter ycbZp4 1018460 reverse Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter TSS_1261 1019168 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1262 1019186 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1263 1019190 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1264 1019205 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1265 1019248 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1266 1019250 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1267 1019362 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1268 1019382 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1269 1019401 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1270 1019732 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1271 1019778 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1272 1019848 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1273 1019850 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1274 1019917 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1275 1019929 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1276 1019931 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1277 1019980 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1278 1020044 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1279 1020049 reverse nd [RS-EPT-CBR] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Buss J., Coltharp C., Huang T., Pohlmeyer C., Wang SC., Hatem C., Xiao J., 2013, In vivo organization of the FtsZ-ring by ZapA and ZapB revealed by quantitative super-resolution microscopy., Mol Microbiol 89(6):1099-120

 [2] Cagliero C., Grand RS., Jones MB., Jin DJ., O'Sullivan JM., 2013, Genome conformation capture reveals that the Escherichia coli chromosome is organized by replication and transcription., Nucleic Acids Res 41(12):6058-71

 [3] Lesterlin C., Gigant E., Boccard F., Espeli O., 2012, Sister chromatid interactions in bacteria revealed by a site-specific recombination assay., EMBO J 31(16):3468-79

 [4] Mercier R., Espeli O., Boccard F., 2009, [Bacterial chromosome organization]., Med Sci (Paris) 25(11):885-7

 [5] Thiel A., Valens M., Vallet-Gely I., Espeli O., Boccard F., 2012, Long-range chromosome organization in E. coli: a site-specific system isolates the Ter macrodomain., PLoS Genet 8(4):e1002672

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB