RegulonDB RegulonDB 10.8: Gene Form
   

yfiM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pssA kgtP yfiM yfiS pssL TSS_2901 TSS_2901 kgtPp8 kgtPp8 kgtPp6 kgtPp6 kgtPp7 kgtPp7 TSS_2900 TSS_2900 TSS_2899 TSS_2899 TSS_2898 (cluster) TSS_2898 (cluster) yfiMp2 yfiMp2 TSS_2897 TSS_2897

Gene      
Name: yfiM    Texpresso search in the literature
Synonym(s): ECK2584, EG12857, b2586
Genome position(nucleotides): 2724128 --> 2724451 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.7
External database links:  
ASAP:
ABE-0008513
ECHOBASE:
EB2700
OU-MICROARRAY:
b2586
PortEco:
yfiM
STRING:
511145.b2586
COLOMBOS: yfiM


Product      
Name: protein YfiM
Synonym(s): YfiM
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 11.805
Isoelectric point: 6.942
Motif(s):
 
Type Positions Sequence
24 -> 99 SGQDKAQHFIASAMLSAAGNEYSQHQGMSRDRSAMFGLMFSVSLGASKELWDSRPEGSGWSWKDLAWDVAGASTGY

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
EG12857-MONOMER
ECOLIWIKI:
b2586
INTERPRO:
IPR018736
INTERPRO:
IPR017028
PFAM:
PF10043
PRIDE:
P46126
REFSEQ:
NP_417081
SMR:
P46126
UNIPROT:
P46126


Operon      
Name: yfiM         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2897 2723828 forward nd [RS-EPT-CBR] [2]
  promoter yfiMp2 2724033 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_2898 (cluster) 2724586 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2899 2724730 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2900 2725342 reverse nd [RS-EPT-CBR] [2]
  promoter kgtPp7 2725760 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter kgtPp6 2725809 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter kgtPp8 2725812 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_2901 2725834 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB