RegulonDB RegulonDB 10.7: Gene Form
   

yecF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sdiA uvrY yecF yecC3\' yecU LexA yecFp yecFp uvrYp2 uvrYp2 TSS_2249 (cluster) TSS_2249 (cluster)

Gene      
Name: yecF    Texpresso search in the literature
Synonym(s): ECK1914, EG12861, b1915
Genome position(nucleotides): 1995818 --> 1996042 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.0
External database links:  
ASAP:
ABE-0006379
ECHOBASE:
EB2703
OU-MICROARRAY:
b1915
PORTECO:
yecF
REGULONDB:
b1915
STRING:
511145.b1915
M3D: yecF
COLOMBOS: yecF
PortEco: b1915


Product      
Name: DUF2594 domain-containing protein YecF
Synonym(s): YecF
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 8.239
Isoelectric point: 4.965
Motif(s):
 
Type Positions Sequence
1 -> 74 MSTPDFSTAENNQELANEVSCLKAMLTLMLQAMGQADAGRVMLKMEKQLALIEDETQAAVFSKTVKQIKQAYRQ

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12861-MONOMER
ECOLIWIKI:
b1915
INTERPRO:
IPR019705
PFAM:
PF10769
PRIDE:
P0AD07
PROTEINMODELPORTAL:
P0AD07
REFSEQ:
NP_416425
UNIPROT:
P0AD07


Operon      
Name: yecF         
Operon arrangement:
Transcription unit        Promoter
yecF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2249 (cluster) 1995403 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB