RegulonDB RegulonDB 10.8: Gene Form
   

ydcH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

opgD rimL ydcH unknown ydcK terminator anti-terminator anti-anti-terminator rimLp rimLp TSS_1808 TSS_1808 TSS_1807 TSS_1807 TSS_1806 TSS_1806

Gene      
Name: ydcH    Texpresso search in the literature
Synonym(s): ECK1419, EG12865, b1426
Genome position(nucleotides): 1498651 --> 1498875 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.33
External database links:  
ASAP:
ABE-0004761
ECHOBASE:
EB2706
OU-MICROARRAY:
b1426
PortEco:
ydcH
STRING:
511145.b1426
COLOMBOS: ydcH


Product      
Name: protein YdcH
Synonym(s): YdcH
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 8.878
Isoelectric point: 9.94
Motif(s):
 
Type Positions Sequence
19 -> 66 FMSLFDKHNKLDHEIARKEGSDGRGYNAEVVRMKKQKLQLKDEMLKIL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12865-MONOMER
ECOLIWIKI:
b1426
INTERPRO:
IPR038444
INTERPRO:
IPR007420
PFAM:
PF04325
PRIDE:
P0ACW6
REFSEQ:
NP_415943
SMR:
P0ACW6
UNIPROT:
P0ACW6


Operon      
Name: ydcH         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1806 1497690 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1807 1497713 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1808 1497832 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB