RegulonDB RegulonDB 10.8: Gene Form
   

yciN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

topA sohB yciN Fis Fis Fis Fis Fis Fis Fis Fis Fis Fis Fis TSS_1717 TSS_1717 TSS_1716 TSS_1716 TSS_1715 TSS_1715 topAp1 topAp1 topAp2 topAp2 topAp3 topAp3 topAp4 topAp4 yciNp5 yciNp5 TSS_1713 TSS_1713 yciNp11 yciNp11 topAp5 topAp5 yciNp9 yciNp9 TSS_1712 TSS_1712 yciNp8 yciNp8 yciNp10 yciNp10 TSS_1711 (cluster) TSS_1711 (cluster) TSS_1710 TSS_1710

Gene      
Name: yciN    Texpresso search in the literature
Synonym(s): ECK1267, EG12868, b1273
Genome position(nucleotides): 1330417 <-- 1330668 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.22
External database links:  
ASAP:
ABE-0004269
ECHOBASE:
EB2709
OU-MICROARRAY:
b1273
PortEco:
yciN
STRING:
511145.b1273
COLOMBOS: yciN


Product      
Name: protein YciN
Synonym(s): YciN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.386
Isoelectric point: 5.55
Motif(s):
 
Type Positions Sequence
43 -> 83 LVFTGDYFLDEQGLPTAKSTAVFNMFKHLAHVLSEKYHLVD
4 -> 81 ETQPIDRETLLKEANKIIREHEDTLAGIEATGVTQRNGVLVFTGDYFLDEQGLPTAKSTAVFNMFKHLAHVLSEKYHL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-35851N
ECOCYC:
EG12868-MONOMER
ECOLIWIKI:
b1273
INTERPRO:
IPR019633
INTERPRO:
IPR038191
PFAM:
PF10692
PRIDE:
P0AB61
REFSEQ:
NP_415789
SMR:
P0AB61
UNIPROT:
P0AB61


Operon      
Name: yciN         
Operon arrangement:
Transcription unit        Promoter
yciN


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1710 1330684 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1711 (cluster) 1330687 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter yciNp10 1330689 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yciNp8 1330702 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1712 1330714 reverse nd [RS-EPT-CBR] [1]
  promoter yciNp9 1330757 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yciNp11 1330790 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1713 1330791 forward nd [RS-EPT-CBR] [1]
  promoter yciNp5 1330803 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1715 1331232 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1716 1331471 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1717 1332403 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB