RegulonDB RegulonDB 10.6.3: Gene Form
   

ycjF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tyrR ycjX ycjF ycjW TyrR TyrR TSS_1747 TSS_1747 tyrRp tyrRp TSS_1746 TSS_1746 ycjXp ycjXp ycjWp2 ycjWp2 TSS_1745 TSS_1745

Gene      
Name: ycjF    Texpresso search in the literature
Synonym(s): ECK1318, EG12870, b1322
Genome position(nucleotides): 1385511 --> 1386572 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.31
External database links:  
ASAP:
ABE-0004436
ECHOBASE:
EB2711
ECOCYC:
EG12870
ECOLIHUB:
ycjF
OU-MICROARRAY:
b1322
REGULONDB:
b1322
STRING:
511145.b1322
M3D: ycjF
COLOMBOS: ycjF
PortEco: b1322


Product      
Name: DUF697 domain-containing inner membrane protein YcjF
Synonym(s): YcjF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 39.392
Isoelectric point: 8.814
Motif(s):
 
Type Positions Sequence
349 -> 349 T
70 -> 90 MVMGGLALFGASVVGQGVQWT
100 -> 120 VALGGCAAGALIIGAGVGSVV
183 -> 341 NDREVVSLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLINRIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIGAGLLTARLGIKAMELCRPLPWIDDDKPRLGDFRRQLIGQVK
213 -> 233 ESTLMIAVSPLALVDMAFIAW

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48099N
ECOCYC:
EG12870-MONOMER
ECOLIWIKI:
b1322
INTERPRO:
IPR006507
INTERPRO:
IPR021147
MINT:
MINT-1265032
PANTHER:
PTHR39342
PFAM:
PF05128
PRIDE:
P0A8R7
PROTEINMODELPORTAL:
P0A8R7
REFSEQ:
NP_415838
UNIPROT:
P0A8R7


Operon      
Name: ycjXF-tyrR         
Operon arrangement:
Transcription unit        Promoter
ycjXF-tyrR
tyrR
null


Transcriptional Regulation      
Display Regulation             
Repressed by: PgrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1745 1383989 reverse nd [RS-EPT-CBR] [1]
  promoter ycjWp2 1383991 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1746 1386691 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1747 1387697 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB