RegulonDB RegulonDB 10.8: Gene Form
   

ybhC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybhJ ybhC ybhB TSS_940 (cluster) TSS_940 (cluster) ybhCp ybhCp TSS_939 TSS_939

Gene      
Name: ybhC    Texpresso search in the literature
Synonym(s): ECK0761, EG12875, b0772
Genome position(nucleotides): 805998 <-- 807281 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.35
External database links:  
ASAP:
ABE-0002629
ECHOBASE:
EB2713
OU-MICROARRAY:
b0772
PortEco:
ybhC
STRING:
511145.b0772
COLOMBOS: ybhC


Product      
Name: outer membrane lipoprotein YhbC
Synonym(s): YbhC
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 46.082
Isoelectric point: 5.766
Motif(s):
 
Type Positions Sequence
22 -> 427 CSSTPPDQRPSDQTAPGTSSRPILSAKEAQNFDAQHYFASLTPGAAAWNPSPITLPAQPDFVVGPAGTQGVTHTTIQAAVDAAIIKRTNKRQYIAVMPGEYQGTVYVPAAPGGITLYGTGEKPIDVKIGLSLDGGMSPADWRHDVNPRGKYMPGKPAWYMYDSCQSKRSDSIGVLCSAVFWSQNNGLQLQNLTIENTLGDSVDAGNHPAVALRTDGDQVQINNVNILGRQNTFFVTNSGVQNRLETNRQPRTLVTNSYIEGDVDIVSGRGAVVFDNTEFRVVNSRTQQEAYVFAPATLSNIYYGFLAVNSRFNAFGDGVAQLGRSLDVDANTNGQVVIRDSAINEGFNTAKPWADAVISNRPFAGNTGSVDDNDEIQRNLNDTNYNRMWEYNNRGVGSKVVAEAKK
167 -> 167 N
1 -> 21 MNTFSVSRLALALAFGVTLTA
194 -> 318 GVLCSAVFWSQNNGLQLQNLTIENTLGDSVDAGNHPAVALRTDGDQVQINNVNILGRQNTFFVTNSGVQNRLETNRQPRTLVTNSYIEGDVDIVSGRGAVVFDNTEFRVVNSRTQQEAYVFAPAT

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
molecular_function GO:0016787 - hydrolase activity
GO:0030599 - pectinesterase activity
GO:0045330 - aspartyl esterase activity
GO:0052689 - carboxylic ester hydrolase activity
biological_process GO:0042545 - cell wall modification
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11407N
ECOCYC:
EG12875-MONOMER
ECOLIWIKI:
b0772
INTERPRO:
IPR000070
INTERPRO:
IPR033131
INTERPRO:
IPR012334
INTERPRO:
IPR011050
MINT:
MINT-1240146
MODBASE:
P46130
PDB:
3GRH
PFAM:
PF01095
PRIDE:
P46130
PROSITE:
PS00800
PROSITE:
PS00503
REFSEQ:
NP_415293
SMR:
P46130
UNIPROT:
P46130


Operon      
Name: ybhC         
Operon arrangement:
Transcription unit        Promoter
ybhC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_939 807309 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_940 (cluster) 807324 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB