RegulonDB RegulonDB 10.9: Gene Form
   

gss gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gss pitB yghU TSS_3305 TSS_3305 yghUp yghUp gssp gssp pitBp pitBp

Gene      
Name: gss    Texpresso search in the literature
Synonym(s): ECK2982, EG12882, b2988, gsp
Genome position(nucleotides): 3136663 <-- 3138522 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.47
External database links:  
ASAP:
ABE-0009804
ECHOBASE:
EB2720
ECOLIHUB:
gsp
OU-MICROARRAY:
b2988
STRING:
511145.b2988
COLOMBOS: gss


Product      
Name: fused glutathionylspermidine amidase / glutathionylspermidine synthetase
Synonym(s): Gsp, Gss
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 70.532
Isoelectric point: 4.94
Motif(s):
 
Type Positions Sequence
59 -> 59 C
250 -> 615 YHYYTITESAEQELIKATNELHLMYLHATDKVLKDDNLLALFDIPKILWPRLRLSWQRRRHHMITGRMDFCMDERGLKVYEYNADSASCHTEAGLILERWAEQGYKGNGFNPAEGLINELAGAWKHSRARPFVHIMQDKDIEENYHAQFMEQALHQAGFETRILRGLDELGWDAAGQLIDGEGRLVNCVWKTWAWETAFDQIREVSDREFAAVPIRTGHPQNEVRLIDVLLRPEVLVFEPLWTVIPGNKAILPILWSLFPHHRYLLDTDFTVNDELVKTGYAVKPIAGRCGSNIDLVSHHEEVLDKTSGKFAEQKNIYQQLWCLPKVDGKYIQVCTFTVGGNYGGTCLRGDESLVIKKESDIEPLI
316 -> 316 R
392 -> 392 E
538 -> 538 R

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.14 - polyamine biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0016874 - ligase activity
GO:0008884 - glutathionylspermidine amidase activity
GO:0008885 - glutathionylspermidine synthase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0008152 - metabolic process
GO:0006749 - glutathione metabolic process
GO:0008216 - spermidine metabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-36018N
ECOCYC:
GSP-MONOMER
ECOLIWIKI:
b2988
INTERPRO:
IPR038765
INTERPRO:
IPR016185
INTERPRO:
IPR005494
INTERPRO:
IPR007921
PDB:
2IO8
PDB:
3O98
PDB:
3A30
PDB:
3A2Z
PDB:
3A2Y
PDB:
2IOB
PDB:
2IOA
PDB:
2IO9
PDB:
2IO7
PFAM:
PF05257
PFAM:
PF03738
PRIDE:
P0AES0
PRODB:
PRO_000022849
PROSITE:
PS50911
REFSEQ:
NP_417462
SMR:
P0AES0
UNIPROT:
P0AES0


Operon      
Name: gss         
Operon arrangement:
Transcription unit        Promoter
gss


Regulation by small RNA    
  Display Regulation
small RNA spf


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3305 3138702 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB