RegulonDB RegulonDB 10.7: Gene Form
   

dsdC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dsdX dsdC torI pawZ NsrR CRP CRP dsdAp dsdAp TSS_2663 TSS_2663 dsdXp dsdXp dsdCp dsdCp TSS_2662 (cluster) TSS_2662 (cluster)

Gene      
Name: dsdC    Texpresso search in the literature
Synonym(s): ECK2360, EG13161, b2364
Genome position(nucleotides): 2476694 <-- 2477629 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.08
External database links:  
ASAP:
ABE-0007797
ECHOBASE:
EB2953
ECOO157CYC:
Z0885
OU-MICROARRAY:
b2364
PORTECO:
dsdC
REGULONDB:
b2364
STRING:
511145.b2364
M3D: dsdC
COLOMBOS: dsdC
PortEco: b2364


Product      
Name: DNA-binding transcriptional dual regulator DsdC
Synonym(s): DsdC
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LysR
Cellular location: cytosol
Molecular weight: 35.332
Isoelectric point: 7.073
Motif(s):
 
Type Positions Sequence
32 -> 51 FALAAEELSLSPSAVSHRIN
15 -> 72 WQLSKMHTFEVAARHQSFALAAEELSLSPSAVSHRINQLEEELGIQLFVRSHRKVELT
99 -> 307 QELSGTLTLYSRPSIAQCWLVPALGDFTRRYPSISLTVLTGNDNVNLQRAGIDLAIYFDDAPSAQLTHHFLMDEEILPVCSPEYAQRHALTNTVINLCHCTLLHDRQAWSNDSGTDEWHSWAQHYAVNLPTSSGIGFDRSDLAVIAAMNHIGVAMGRKRLVQKRLASGELVAPFGDMTVKCHQHYYITTLPGRQWPKIEAFIIWLREQV
18 -> 76 SKMHTFEVAARHQSFALAAEELSLSPSAVSHRINQLEEELGIQLFVRSHRKVELTHEGK
159 -> 159 A

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
Reference(s): [1] McFall E., et al., 1983
[2] Norregaard-Madsen M., et al., 1995
External database links:  
DIP:
DIP-9480N
ECOCYC:
PD00297
ECOLIWIKI:
b2364
ECOO157CYC:
Z0885-MONOMER
INTERPRO:
IPR000847
INTERPRO:
IPR005119
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR011781
MODBASE:
P46068
PFAM:
PF00126
PFAM:
PF03466
PRIDE:
P46068
PRINTS:
PR00039
PRODB:
PRO_000022486
PROSITE:
PS50931
PROTEINMODELPORTAL:
P46068
REFSEQ:
NP_416865
SMR:
P46068
UNIPROT:
P46068


Operon      
Name: dsdC         
Operon arrangement:
Transcription unit        Promoter
dsdC


Transcriptional Regulation      
Display Regulation             
Repressed by: NsrR, DsdC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2662 (cluster) 2476376 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2663 2479114 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] McFall E., Heincz MC., 1983, Identification and control of synthesis of the dsdC activator protein., J Bacteriol 153(2):872-7

 [2] Norregaard-Madsen M., McFall E., Valentin-Hansen P., 1995, Organization and transcriptional regulation of the Escherichia coli K-12 D-serine tolerance locus., J Bacteriol 177(22):6456-61

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB