RegulonDB RegulonDB 10.7: Gene Form
   

ybaE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybaE cof queC anti-terminator anti-anti-terminator terminator terminator TSS_607 (cluster) TSS_607 (cluster)

Gene      
Name: ybaE    Texpresso search in the literature
Synonym(s): ECK0439, EG13217, b0445
Genome position(nucleotides): 465612 <-- 467312 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.97
External database links:  
ASAP:
ABE-0001542
ECHOBASE:
EB3008
OU-MICROARRAY:
b0445
PORTECO:
ybaE
REGULONDB:
b0445
STRING:
511145.b0445
M3D: ybaE
COLOMBOS: ybaE
PortEco: b0445


Product      
Name: uncharacterized protein YbaE
Synonym(s): YbaE
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 64.992
Isoelectric point: 7.322
Motif(s):
 
Type Positions Sequence
6 -> 118 RLNQYQRLWQPSAGKPQTVTVSELAERCFCSERHVRTLLRQAQEAGWLEWQAQSGRGKRGQLRFLVTPESLRNAMMEQALETGKQQDVLELAQLAPGELRTLLQPFMGGQWQN
165 -> 303 PIGDLAHHWETSTDGLRWDFYLRSTLHWHNGDAVKASHLHQRLLMLLQLPALDQLFISVKRIEVTHPQCLTFFLHRPDYWLAHRLASYCSHLAHPQFPLIGTGPFRLTQFTAELVRLESHDYYHLRHPLLKAVEYWITP

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
molecular_function GO:1904680 - peptide transmembrane transporter activity
biological_process GO:0042886 - amide transport
Note(s): Note(s): ...[more].
Reference(s): [1] Riley M., et al., 2006
External database links:  
ECOCYC:
EG13217-MONOMER
ECOLIWIKI:
b0445
INTERPRO:
IPR025370
INTERPRO:
IPR039424
INTERPRO:
IPR000914
MODBASE:
P46890
PANTHER:
PTHR30290
PFAM:
PF12793
PFAM:
PF00496
PRIDE:
P46890
PROTEINMODELPORTAL:
P46890
REFSEQ:
NP_414979
SMR:
P46890
UNIPROT:
P46890


Operon      
Name: ybaE         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_607 (cluster) 467382 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Riley M., Abe T., Arnaud MB., Berlyn MK., Blattner FR., Chaudhuri RR., Glasner JD., Horiuchi T., Keseler IM., Kosuge T., Mori H., Perna NT., Plunkett G., Rudd KE., Serres MH., Thomas GH., Thomson NR., Wishart D., Wanner BL., 2006, Escherichia coli K-12: a cooperatively developed annotation snapshot--2005., Nucleic Acids Res 34(1):1-9

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB