RegulonDB RegulonDB 10.6.3: Gene Form
   

dgoA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgoT dgoD dgoK dgoR dgoA cbrA terminator

Gene      
Name: dgoA    Texpresso search in the literature
Synonym(s): ECK3685, EG20049, b3692, b4477, yidU
Genome position(nucleotides): 3872995 <-- 3873612 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
59.39
External database links:  
ASAP:
ABE-0174107
CGSC:
36891
ECHOBASE:
EB1667
ECOCYC:
EG20049
ECOLIHUB:
dgoA
OU-MICROARRAY:
b3692
REGULONDB:
b4477
STRING:
511145.b4477
M3D: dgoA
COLOMBOS: dgoA
PortEco: b3692


Product      
Name: 2-dehydro-3-deoxy-6-phosphogalactonate aldolase
Synonym(s): DgoA, YidU
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.391
Isoelectric point: 4.749
Motif(s):
 
Type Positions Sequence
37 -> 37 E
5 -> 183 TKLPLIAILRGITPDEALAHVGAVIDAGFDAVEIPLNSPQWEQSIPAIVDAYGDKALIGAGTVLKPEQVDALARMGCQLIVTPNIHSEVIRRAVGYGMTVCPGCATATEAFTALEAGAQALKIFPSSAFGPQYIKALKAVLPSDIAVFAVGGVTPENLAQWIDAGCAGAGLGSDLYRAG
154 -> 154 V
176 -> 177 GS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0008674 - 2-dehydro-3-deoxy-6-phosphogalactonate aldolase activity
biological_process GO:0034194 - D-galactonate catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
DEHYDDEOXPHOSGALACT-ALDOL-MONOMER
ECOLIWIKI:
b4477
INTERPRO:
IPR013785
INTERPRO:
IPR000887
MODBASE:
Q6BF16
PANTHER:
PTHR30246
PDB:
4QCC
PDB:
2V82
PDB:
2V81
PFAM:
PF01081
PRIDE:
Q6BF16
PRODB:
PRO_000022433
PROTEINMODELPORTAL:
Q6BF16
REFSEQ:
YP_026238
SMR:
Q6BF16
UNIPROT:
Q6BF16


Operon      
Name: dgoRKADT         
Operon arrangement:
Transcription unit        Promoter
null


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: DgoR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB