RegulonDB RegulonDB 10.6.3: Gene Form
   

dgoK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgoD dgoK dgoR yidX dgoA CRP DgoR DgoR TSS_4257 TSS_4257 dgoRp dgoRp

Gene      
Name: dgoK    Texpresso search in the literature
Synonym(s): ECK3686, EG20051, b3693, yidV
Genome position(nucleotides): 3873596 <-- 3874474 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.15
External database links:  
ASAP:
ABE-0012076
CGSC:
858
ECHOBASE:
EB1668
ECOCYC:
EG20051
ECOLIHUB:
dgoK
OU-MICROARRAY:
b3693
REGULONDB:
b3693
STRING:
511145.b3693
M3D: dgoK
COLOMBOS: dgoK
PortEco: b3693


Product      
Name: 2-dehydro-3-deoxygalactonokinase
Synonym(s): DgoK, YidV
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.374
Isoelectric point: 5.931
Motif(s):
 
Type Positions Sequence
9 -> 285 DWGSTNLRAWLYQGDHCLESRQSEAGVTRLNGKSPAAVLAEVTTDWREEKTPVVMAGMVGSNVGWKVAPYLSVPACFSSIGEQLTSVGDNIWIIPGLCVSHDDNHNVMRGEETQLIGARALAPSSLYVMPGTHCKWVQADSQQINDFRTVMTGELHHLLLNHSLIGAGLPPQENSADAFTAGLERGLNTPAILPQLFEVRASHVLGTLPREQVSEFLSGLLIGAEVASMRDYVAHQHAITLVAGTSLTARYQQAFQAMGCDVTAVAGDTAFQAGIRS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008671 - 2-dehydro-3-deoxygalactonokinase activity
biological_process GO:0016310 - phosphorylation
GO:0034194 - D-galactonate catabolic process
GO:0046835 - carbohydrate phosphorylation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
DEHYDDEOXGALACTKIN-MONOMER
ECOLIWIKI:
b3693
INTERPRO:
IPR007729
PFAM:
PF05035
PRIDE:
P31459
PRODB:
PRO_000022435
PROTEINMODELPORTAL:
P31459
REFSEQ:
NP_418148
SMR:
P31459
UNIPROT:
P31459


Operon      
Name: dgoRKADT         
Operon arrangement:
Transcription unit        Promoter
null


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: DgoR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4257 3875186 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB