RegulonDB RegulonDB 10.7: Gene Form
   

hpt gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gcd can hpt IHF CRP TSS_268 TSS_268 TSS_267 (cluster) TSS_267 (cluster) hptp hptp gcdp2 gcdp2 gcdp1 gcdp1

Gene      
Name: hpt    Texpresso search in the literature
Synonym(s): ECK0124, EG20098, b0125
Genome position(nucleotides): 141431 --> 141967 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.65
External database links:  
ASAP:
ABE-0000440
CGSC:
622
ECHOBASE:
EB4143
MIM:
300322
MIM:
300323
NCBI-GENE:
946624
OU-MICROARRAY:
b0125
PORTECO:
hpt
REGULONDB:
b0125
STRING:
511145.b0125
M3D: hpt
COLOMBOS: hpt
PortEco: b0125


Shine dalgarno      
Sequence: taaatcatatGGTTAGagatATG


Product      
Name: hypoxanthine phosphoribosyltransferase
Synonym(s): Hpt
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.115
Isoelectric point: 4.825
Motif(s):
 
Type Positions Sequence
13 -> 160 EIKARIAELGRQITERYKDSGSDMVLVGLLRGSFMFMADLCREVQVSHEVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDY
99 -> 108 EDIIDSGNTL
158 -> 159 ID

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0004422 - hypoxanthine phosphoribosyltransferase activity
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
GO:0052657 - guanine phosphoribosyltransferase activity
GO:0097216 - guanosine tetraphosphate binding
biological_process GO:0006178 - guanine salvage
GO:0009116 - nucleoside metabolic process
GO:0006166 - purine ribonucleoside salvage
GO:0006168 - adenine salvage
GO:0032263 - GMP salvage
GO:0032264 - IMP salvage
GO:0046100 - hypoxanthine metabolic process
GO:0051289 - protein homotetramerization
External database links:  
DIP:
DIP-47994N
ECOCYC:
HYPOXANPRIBOSYLTRAN-MONOMER
ECOLIWIKI:
b0125
INTERPRO:
IPR029057
INTERPRO:
IPR005904
INTERPRO:
IPR000836
MODBASE:
P0A9M2
PDB:
5KNX
PDB:
5KNV
PDB:
5KNU
PDB:
5KNT
PDB:
5KNS
PDB:
5KNR
PDB:
1GRV
PDB:
1G9T
PDB:
1G9S
PFAM:
PF00156
PRIDE:
P0A9M2
PRODB:
PRO_000022921
PROSITE:
PS00103
PROTEINMODELPORTAL:
P0A9M2
REFSEQ:
NP_414667
SMR:
P0A9M2
UNIPROT:
P0A9M2


Operon      
Name: hpt         
Operon arrangement:
Transcription unit        Promoter
hpt


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: IHF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_267 (cluster) 141407 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_268 141650 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB