RegulonDB RegulonDB 10.6.3: Gene Form
   

uxuB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uxuB uxuA uxuR UxuR UxuR ExuR UxuR terminator TSS_5143 (cluster) TSS_5143 (cluster) TSS_5142 TSS_5142 uxuRp uxuRp

Gene      
Name: uxuB    Texpresso search in the literature
Synonym(s): ECK4314, EG20248, b4323
Genome position(nucleotides): 4552901 --> 4554361 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.63
External database links:  
ASAP:
ABE-0014175
CGSC:
13
ECHOBASE:
EB4150
ECOCYC:
EG20248
ECOLIHUB:
uxuB
OU-MICROARRAY:
b4323
REGULONDB:
b4323
STRING:
511145.b4323
M3D: uxuB
COLOMBOS: uxuB
PortEco: b4323


Product      
Name: D-mannonate oxidoreductase
Synonym(s): UxuB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 53.58
Isoelectric point: 5.194
Motif(s):
 
Type Positions Sequence
24 -> 188 RIVHLGCGAFHRAHQALYTHHLLESTDSDWGICEVNLMPGNDRVLIENLKKQQLLYTVAEKGAESTELKIIGSMKEALHPEIDGCEGILNAMARPQTAIVSLTVTEKGYCADAASGQLDLNNPLIKHDLENPTAPKSAIGYIVEALRLRREKGLKAFTVMSCDNV
25 -> 36 IVHLGCGAFHRA
216 -> 463 ENVTFPCTMVDRIVPAATPETLQEIADQLGVYDPCAIACEPFRQWVIEDNFVNGRPDWDKVGAQFVADVVPFEMMKLRMLNGSHSFLAYLGYLGGYETIADTVTNPAYRKAAFALMMQEQAPTLSMPEGTDLNAYATLLIERFSNPSLRHRTWQIAMDGSQKLPQRLLDPVRLHLQNGGSWRHLALGVAGWMRYTQGVDEQGNAIDVVDPMLAEFQKINAQYQGADRVKALLGLSGIFADDLPQNADF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016491 - oxidoreductase activity
GO:0050662 - coenzyme binding
GO:0008866 - fructuronate reductase activity
biological_process GO:0042840 - D-glucuronate catabolic process
GO:0055114 - oxidation-reduction process
GO:0019594 - mannitol metabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11109N
ECOCYC:
MANNONOXIDOREDUCT-MONOMER
ECOLIWIKI:
b4323
INTERPRO:
IPR013328
INTERPRO:
IPR036291
INTERPRO:
IPR023027
INTERPRO:
IPR013131
INTERPRO:
IPR013118
INTERPRO:
IPR008927
INTERPRO:
IPR000669
MODBASE:
P39160
PFAM:
PF08125
PFAM:
PF01232
PRIDE:
P39160
PRINTS:
PR00084
PRODB:
PRO_000024207
PROSITE:
PS00974
PROTEINMODELPORTAL:
P39160
REFSEQ:
NP_418743
SMR:
P39160
SWISSMODEL:
P39160
UNIPROT:
P39160


Operon      
Name: uxuAB         
Operon arrangement:
Transcription unit        Promoter
uxuAB


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: OxyR, ExuR, UxuR


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5142 4554477 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5143 (cluster) 4554479 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB