RegulonDB RegulonDB 10.6.3: Gene Form
   

uxuR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uxuB yjiC uxuR UxuR UxuR ExuR UxuR TSS_5143 (cluster) TSS_5143 (cluster) TSS_5142 TSS_5142 uxuRp uxuRp

Gene      
Name: uxuR    Texpresso search in the literature
Synonym(s): ECK4315, EG20249, b4324
Genome position(nucleotides): 4554576 --> 4555349 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.62
External database links:  
ASAP:
ABE-0014179
CGSC:
12
ECHOBASE:
EB4151
ECOCYC:
EG20249
ECOLIHUB:
uxuR
OU-MICROARRAY:
b4324
REGULONDB:
b4324
STRING:
511145.b4324
M3D: uxuR
COLOMBOS: uxuR
PortEco: b4324


Product      
Name: DNA-binding transcriptional repressor UxuR
Synonym(s): UxuR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: GntR
Cellular location: cytosol
Molecular weight: 29.308
Isoelectric point: 4.762
Motif(s):
 
Type Positions Sequence
10 -> 73 PYQEVGAMIRDLIIKTPYNPGERLPPEREIAEMLDVTRTVVREALIMLEIKGLVEVRRGAGIYV
8 -> 76 QRPYQEVGAMIRDLIIKTPYNPGERLPPEREIAEMLDVTRTVVREALIMLEIKGLVEVRRGAGIYVLDN
97 -> 225 ELLQARQLLESNIAEFAALQATREDIVKMRQALQLEERELASSAPGSSESGDMQFHLAIAEATHNSMLVELFRQSWQWRENNPMWIQLHSHLDDSLYRKEWLGDHKQILAALIKKDARAAKLAMWQHLE
36 -> 55 EREIAEMLDVTRTVVREALI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [IEP] Inferred from expression pattern
Reference(s): [1] Blanco C. 1987
[2] Blanco C., et al., 1986
External database links:  
DIP:
DIP-11110N
ECOCYC:
EG20249-MONOMER
ECOLIWIKI:
b4324
INTERPRO:
IPR036390
INTERPRO:
IPR011711
INTERPRO:
IPR008920
INTERPRO:
IPR000524
INTERPRO:
IPR036388
MODBASE:
P39161
PFAM:
PF00392
PFAM:
PF07729
PRIDE:
P39161
PRINTS:
PR00035
PRODB:
PRO_000024208
PROSITE:
PS50949
PROTEINMODELPORTAL:
P39161
REFSEQ:
NP_418744
SMART:
SM00895
SMART:
SM00345
SMR:
P39161
UNIPROT:
P39161


Operon      
Name: uxuR         
Operon arrangement:
Transcription unit        Promoter
uxuR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: ExuR, UxuR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5142 4554477 forward nd [RS-EPT-CBR] [3]
  promoter TSS_5143 (cluster) 4554479 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Blanco C., 1987, Transcriptional and translational signals of the uidA gene in Escherichia coli K12., Mol Gen Genet 208(3):490-8

 [2] Blanco C., Ritzenthaler P., Kolb A., 1986, The regulatory region of the uxuAB operon in Escherichia coli K12., Mol Gen Genet 202(1):112-9

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB