RegulonDB RegulonDB 10.6.3: Gene Form
   

xylR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

xylH xylR bax xylG terminator anti-terminator TSS_4171 TSS_4171 xylRp xylRp

Gene      
Name: xylR    Texpresso search in the literature
Synonym(s): ECK3558, EG20253, b3569
Genome position(nucleotides): 3734979 --> 3736157 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.77
External database links:  
ASAP:
ABE-0011652
CGSC:
3
ECHOBASE:
EB4154
ECOCYC:
EG20253
ECOLIHUB:
xylR
OU-MICROARRAY:
b3569
REGULONDB:
b3569
STRING:
511145.b3569
M3D: xylR
COLOMBOS: xylR
PortEco: b3569


Product      
Name: DNA-binding transcriptional dual regulator XylR
Synonym(s): XylR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: AraC/XylS
Cellular location: cytosol
Molecular weight: 44.869
Isoelectric point: 6.576
Motif(s):
 
Type Positions Sequence
309 -> 384 DAVGISRSNLEKRFKEEVGETIHAMIHAEKLEKARSLLISTTLSINEISQMCGYPSLQYFYSVFKKAYDTTPKEYR
304 -> 323 VDQVLDAVGISRSNLEKRFK
113 -> 277 HLKEKGVNRFAFYGLPESSGKRWATEREYAFRQLVAEEKYRGVVYQGLETAPENWQHAQNRLADWLQTLPPQTGIIAVTDARARHILQVCEHLHIPVPEKLCVIGIDNEELTRYLSRVALSSVAQGARQMGYQAAKLLHRLLDKEEMPLQRILVPPVRVIERRST

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG20253-MONOMER
ECOLIWIKI:
b3569
INTERPRO:
IPR028082
INTERPRO:
IPR020449
INTERPRO:
IPR018062
INTERPRO:
IPR018060
INTERPRO:
IPR009057
MODBASE:
P0ACI3
PANTHER:
PTHR30146:SF7
PDB:
4FE7
PDB:
4FE4
PFAM:
PF12833
PRIDE:
P0ACI3
PRINTS:
PR00032
PROSITE:
PS00041
PROSITE:
PS01124
PROTEINMODELPORTAL:
P0ACI3
REFSEQ:
NP_418026
SMART:
SM00342
SMR:
P0ACI3
UNIPROT:
P0ACI3


Operon      
Name: xylFGHR         
Operon arrangement:
Transcription unit        Promoter
xylFGHR
xylR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, XylR, ArcA
Repressed by: Fis


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4171 3736974 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB