RegulonDB RegulonDB 10.8: Gene Form
   

nrdE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nrdE nrdF nrdI nrdH

Gene      
Name: nrdE    Texpresso search in the literature
Synonym(s): ECK2669, EG20257, b2675
Genome position(nucleotides): 2801348 --> 2803492 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.84
External database links:  
ASAP:
ABE-0008806
ECHOBASE:
EB4158
OU-MICROARRAY:
b2675
PortEco:
nrdE
STRING:
511145.b2675
COLOMBOS: nrdE


Product      
Name: ribonucleoside-diphosphate reductase 2 subunit α
Synonym(s): NrdE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 80.479
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
177 -> 178 SC
386 -> 390 NLCSE
548 -> 548 K
99 -> 171 FQTFLGAWKFYTSYTLKTFDGKRYLEDFADRVTMVALTLAQGDETLALQLTDEMLSGRFQPATPTFLNCGKQQ
176 -> 693 VSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAGAPIKRIENQSSGVIPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKRENADEKIRIKTLSLGVVIPDITFHLAKENAQMALFSPYDVERVYGKPFADVAISQHYDELVADERIRKKYLNARDFFQRLAEIQFESGYPYIMYEDTVNRANPIAGRINMSNLCSEILQVNSASEYDENLDYTRTGHDISCNLGSLNIAHTMDSPDFARTVETAVRGLTAVSDMSHIRSVPSIEAGNAASHAIGLGQMNLHGYLAREGIAYGSPEALDFTNLYFYAITWHALRTSMLLARERGETFAGFKQSRYASGEYFSQYLQGNWQPKTAKVGELFTRSGITLPTREMWAQLRDDVMRYGIYNQNLQAVPPTGSISYINHATSSIHPIVAKVEIRKEGKTGRVYYPAPFMTNENLALYQDAYEIGAEKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIYAWRKGIKTLYY

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005971 - ribonucleoside-diphosphate reductase complex
molecular_function GO:0003824 - catalytic activity
GO:0016491 - oxidoreductase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004748 - ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor
biological_process GO:0008152 - metabolic process
GO:0006260 - DNA replication
GO:0009263 - deoxyribonucleotide biosynthetic process
GO:0015949 - nucleobase-containing small molecule interconversion
GO:0055114 - oxidation-reduction process
External database links:  
DIP:
DIP-359N
ECOCYC:
NRDE-MONOMER
ECOLIWIKI:
b2675
INTERPRO:
IPR013346
INTERPRO:
IPR039718
INTERPRO:
IPR026459
INTERPRO:
IPR013554
INTERPRO:
IPR013509
INTERPRO:
IPR008926
INTERPRO:
IPR000788
MODBASE:
P39452
PANTHER:
PTHR11573
PFAM:
PF00317
PFAM:
PF02867
PFAM:
PF08343
PRIDE:
P39452
PRINTS:
PR01183
PRODB:
PRO_000023405
PROSITE:
PS00089
REFSEQ:
NP_417161
SMR:
P39452
SWISSMODEL:
P39452
UNIPROT:
P39452


Operon      
Name: nrdHIEF         
Operon arrangement:
Transcription unit        Promoter
nrdHIEF


Transcriptional Regulation      
Display Regulation             
Activated by: IscR
Repressed by: Fur, NrdR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB