RegulonDB RegulonDB 10.8: Gene Form
   

acpP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fabF fabG acpP terminator anti-terminator anti-anti-terminator terminator pabCp8 pabCp8 TSS_1417 TSS_1417 TSS_1416 (cluster) TSS_1416 (cluster) TSS_1415 (cluster) TSS_1415 (cluster) TSS_1414 TSS_1414 TSS_1413 (cluster) TSS_1413 (cluster) TSS_1412 TSS_1412 TSS_1411 TSS_1411 TSS_1410 TSS_1410 TSS_1409 TSS_1409 TSS_1408 TSS_1408 acpPp acpPp TSS_1407 (cluster) TSS_1407 (cluster) TSS_1406 (cluster) TSS_1406 (cluster) TSS_1405 (cluster) TSS_1405 (cluster) TSS_1404 TSS_1404 TSS_1403 (cluster) TSS_1403 (cluster) TSS_1402 TSS_1402 TSS_1401 TSS_1401 TSS_1400 TSS_1400

Gene      
Name: acpP    Texpresso search in the literature
Synonym(s): ECK1080, EG50003, b1094
Genome position(nucleotides): 1151615 --> 1151851 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.1
External database links:  
ASAP:
ABE-0003703
CGSC:
31871
ECHOBASE:
EB4297
OU-MICROARRAY:
b1094
PortEco:
acpP
STRING:
511145.b1094
COLOMBOS: acpP


Product      
Name: acyl carrier protein
Synonym(s): ACP, AcpP, apo-ACP, apo-[acyl carrier protein], apoprotein [acyl carrier protein]
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 8.64
Isoelectric point: 3.719
Motif(s):
 
Type Positions Sequence
2 -> 77 STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQ
37 -> 37 S
44 -> 44 V
71 -> 71 D
25 -> 25 N

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.4 - acyl carrier protein
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0008289 - lipid binding
GO:0031177 - phosphopantetheine binding
GO:0000035 - acyl binding
GO:0000036 - acyl carrier activity
biological_process GO:0006629 - lipid metabolic process
GO:0006631 - fatty acid metabolic process
GO:0008610 - lipid biosynthetic process
GO:0009245 - lipid A biosynthetic process
GO:0042493 - response to drug
GO:0006633 - fatty acid biosynthetic process
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
External database links:  
BIGG:
apoACP
DIP:
DIP-29374N
DISPROT:
DP00416
ECOCYC:
EG50003-MONOMER
ECOLIWIKI:
b1094
INTERPRO:
IPR036736
INTERPRO:
IPR009081
INTERPRO:
IPR006162
INTERPRO:
IPR003231
MINT:
MINT-1231626
MODBASE:
P02901
PDB:
2FHS
PDB:
2K92
PDB:
2K93
PDB:
2K94
PDB:
3EJB
PDB:
3EJD
PDB:
3EJE
PDB:
3NY7
PDB:
5KOF
PDB:
5USR
PDB:
5VCB
PDB:
5WGB
PDB:
5WKP
PDB:
6DFL
PDB:
6N3P
PDB:
2FAE
PDB:
2FAD
PDB:
2FAC
PDB:
1T8K
PDB:
1ACP
PDB:
1L0H
PDB:
1L0I
PFAM:
PF00550
PRIDE:
P0A6A8
PRODOM:
PD000887
PROSITE:
PS50075
PROSITE:
PS00012
REFSEQ:
NP_415612
SMR:
P0A6A8
UNIPROT:
P0A6A8


Operon      
Name: yceD-rpmF-plsX-fabHDG-acpP-fabF         
Operon arrangement:
Transcription unit        Promoter
yceD-rpmF
yceD-rpmF
rpmF-plsX-fabHDG
plsX-fabHDG
fabHDG
acpP
acpP-fabF
fabDG-acpP
fabF
fabG-acpP


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1400 1150957 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1401 1151080 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1402 1151229 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1403 (cluster) 1151352 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1404 1151355 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1405 (cluster) 1151357 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1406 (cluster) 1151510 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1407 (cluster) 1151558 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1408 1151576 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1409 1151598 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1410 1151645 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1411 1151715 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1412 1151724 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1413 (cluster) 1151764 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1414 1151773 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1415 (cluster) 1151777 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1416 (cluster) 1152105 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1417 1152173 forward nd [RS-EPT-CBR] [1]
  promoter pabCp8 1153093 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB