RegulonDB RegulonDB 10.8: Gene Form
   

rmf gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pqiC fabA rmf pqiB CRP ppGpp terminator anti-terminator rmfp rmfp rmfp4 rmfp4 rmfp5 rmfp5

Gene      
Name: rmf    Texpresso search in the literature
Synonym(s): ECK0944, EG50004, b0953, res, rimF
Genome position(nucleotides): 1015715 --> 1015882 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.17
External database links:  
ASAP:
ABE-0003227
CGSC:
31760
ECHOBASE:
EB4298
OU-MICROARRAY:
b0953
PortEco:
rmf
STRING:
511145.b0953
COLOMBOS: rmf


Product      
Name: ribosome modulation factor
Synonym(s): Res, RimF, Rmf
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 6.507
Isoelectric point: 11.418
Motif(s):
 
Type Positions Sequence
3 -> 3 R
25 -> 25 S
33 -> 33 T
1 -> 52 MKRQKRDRLERAHQRGYQAGIAGRSKEMCPYQTLNQRSQWLGGWREAMADRV

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  6 - cell structure --> 6.6 - ribosomes
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0043022 - ribosome binding
GO:0003723 - RNA binding
GO:0019843 - rRNA binding
GO:0043024 - ribosomal small subunit binding
biological_process GO:0006417 - regulation of translation
GO:0033554 - cellular response to stress
GO:0032055 - negative regulation of translation in response to stress
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[IEP] Inferred from expression pattern
[IMP] Inferred from mutant phenotype
Reference(s): [1] Aiso T., et al., 2005
[2] Apirakaramwong A., et al., 1999
[3] Bubunenko M., et al., 2007
[4] Wada A., et al., 1995
[5] Yamagishi M., et al., 1993
[6] Yoshida H., et al., 2009
External database links:  
DIP:
DIP-48260N
ECOCYC:
EG50004-MONOMER
ECOLIWIKI:
b0953
INTERPRO:
IPR023200
INTERPRO:
IPR007040
PDB:
6H58
PDB:
4V8G
PDB:
6H4N
PFAM:
PF04957
PRIDE:
P0AFW2
PRODB:
PRO_000023782
PRODOM:
PD051650
REFSEQ:
NP_415473
SMR:
P0AFW2
UNIPROT:
P0AFW2


Operon      
Name: rmf         
Operon arrangement:
Transcription unit        Promoter
rmf
 


Transcriptional Regulation      
Display Regulation             
Activated by: SlyA, CRP, McbR, RcdA, SdiA
Repressed by: ArcA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rmfp5 1015503 forward Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter rmfp4 1015532 forward Similarity to the consensus
Read more >
[ICWHO] [7]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Aiso T., Yoshida H., Wada A., Ohki R., 2005, Modulation of mRNA stability participates in stationary-phase-specific expression of ribosome modulation factor., J Bacteriol 187(6):1951-8

 [2] Apirakaramwong A., Kashiwagi K., Raj VS., Sakata K., Kakinuma Y., Ishihama A., Igarashi K., 1999, Involvement of ppGpp, ribosome modulation factor, and stationary phase-specific sigma factor sigma(S) in the decrease in cell viability caused by spermidine., Biochem Biophys Res Commun 264(3):643-7

 [3] Bubunenko M., Baker T., Court DL., 2007, Essentiality of ribosomal and transcription antitermination proteins analyzed by systematic gene replacement in Escherichia coli., J Bacteriol 189(7):2844-53

 [4] Wada A., Igarashi K., Yoshimura S., Aimoto S., Ishihama A., 1995, Ribosome modulation factor: stationary growth phase-specific inhibitor of ribosome functions from Escherichia coli., Biochem Biophys Res Commun 214(2):410-7

 [5] Yamagishi M., Matsushima H., Wada A., Sakagami M., Fujita N., Ishihama A., 1993, Regulation of the Escherichia coli rmf gene encoding the ribosome modulation factor: growth phase- and growth rate-dependent control., EMBO J 12(2):625-30

 [6] Yoshida H., Ueta M., Maki Y., Sakai A., Wada A., 2009, Activities of Escherichia coli ribosomes in IF3 and RMF change to prepare 100S ribosome formation on entering the stationary growth phase., Genes Cells 14(2):271-80

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB