RegulonDB RegulonDB 10.8: Gene Form
   

eutC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutB eutC eutL terminator anti-terminator

Gene      
Name: eutC    Texpresso search in the literature
Synonym(s): ECK2435, EG50007, b2440
Genome position(nucleotides): 2556410 <-- 2557297 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.64
External database links:  
ASAP:
ABE-0008043
ECHOBASE:
EB4300
OU-MICROARRAY:
b2440
PortEco:
eutC
STRING:
511145.b2440
COLOMBOS: eutC


Product      
Name: ethanolamine ammonia-lyase subunit β
Synonym(s): EutC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.782
Isoelectric point: 6.751
Motif(s):
 
Type Positions Sequence
65 -> 293 DVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINM

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0009350 - ethanolamine ammonia-lyase complex
molecular_function GO:0016829 - lyase activity
GO:0008851 - ethanolamine ammonia-lyase activity
GO:0031419 - cobalamin binding
biological_process GO:0006520 - cellular amino acid metabolic process
GO:0046336 - ethanolamine catabolic process
External database links:  
ECOCYC:
EUTC-MONOMER
ECOLIWIKI:
b2440
INTERPRO:
IPR009246
INTERPRO:
IPR042255
INTERPRO:
IPR042251
PANTHER:
PTHR39330
PDB:
3AO0
PDB:
5YSN
PDB:
5YSR
PDB:
3ANY
PDB:
3ABS
PDB:
3ABR
PDB:
3ABQ
PDB:
3ABO
PFAM:
PF05985
PRIDE:
P19636
PRODB:
PRO_000022537
REFSEQ:
NP_416935
SMR:
P19636
UNIPROT:
P19636


Operon      
Name: eutBCLKR         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB