RegulonDB RegulonDB 10.6.3: Gene Form
   

frmA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

frmA frmB frmR terminator TSS_485 TSS_485

Gene      
Name: frmA    Texpresso search in the literature
Synonym(s): ECK0353, EG50010, adhC, b0356
Genome position(nucleotides): 378462 <-- 379571 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.69
External database links:  
ASAP:
ABE-0001221
ECHOBASE:
EB4303
ECOCYC:
EG50010
ECOLIHUB:
frmA
OU-MICROARRAY:
b0356
REGULONDB:
b0356
STRING:
511145.b0356
M3D: frmA
COLOMBOS: frmA
PortEco: b0356


Product      
Name: S-(hydroxymethyl)glutathione dehydrogenase
Synonym(s): AdhC, FrmA, formaldehyde dehydrogenase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.359
Isoelectric point: 6.237
Motif(s):
 
Type Positions Sequence
41 -> 41 H
197 -> 319 AIGLAVVQGARQAKAGRIIAIDTNPKKFDLARRFGATDCINPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRAALESAHRGWGQSVIIGVAVAGQEISTRPFQLVTGRVWKGSAFGGVKG
28 -> 154 GEVLIKVTHTGVCHTDAFTLSGDDPEGVFPVVLGHEGAGVVVEVGEGVTSVKPGDHVIPLYTAECGECEFCRSGKTNLCVAVRETQGKGLMPDGTTRFSYNGQPLYHYMGCSTFSEYTVVAEVSLAK
46 -> 46 T

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0008270 - zinc ion binding
GO:0004022 - alcohol dehydrogenase (NAD) activity
GO:0042802 - identical protein binding
GO:0051903 - S-(hydroxymethyl)glutathione dehydrogenase activity
GO:0004024 - alcohol dehydrogenase activity, zinc-dependent
biological_process GO:0046294 - formaldehyde catabolic process
GO:0055114 - oxidation-reduction process
GO:0006069 - ethanol oxidation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-2901N
ECOCYC:
ADHC-MONOMER
ECOLIWIKI:
b0356
INTERPRO:
IPR036291
INTERPRO:
IPR020843
INTERPRO:
IPR014183
INTERPRO:
IPR013154
INTERPRO:
IPR013149
INTERPRO:
IPR002328
INTERPRO:
IPR011032
MINT:
MINT-1286770
MODBASE:
P25437
PANTHER:
PTHR11695
PFAM:
PF00107
PFAM:
PF08240
PRIDE:
P25437
PRODB:
PRO_000022694
PROSITE:
PS00059
PROTEINMODELPORTAL:
P25437
REFSEQ:
NP_414890
SMART:
SM00829
SMR:
P25437
SWISSMODEL:
P25437
UNIPROT:
P25437


Operon      
Name: frmRAB         
Operon arrangement:
Transcription unit        Promoter
null


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_485 378418 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB