RegulonDB RegulonDB 10.8: Gene Form
   

hokC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insL1 unknown mokC hokC sokC terminator TSS_41 TSS_41 hokCp4 hokCp4 TSS_40 TSS_40 TSS_39 TSS_39

Gene      
Name: hokC    Texpresso search in the literature
Synonym(s): ECK0017, G0-9563, b4412, gef
Genome position(nucleotides): 16751 <-- 16903 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.94
External database links:  
ASAP:
ABE-0047278
ECHOBASE:
EB0368
ECOO157CYC:
GEF
PortEco:
hokC
STRING:
511145.b4412
COLOMBOS: hokC


Product      
Name: protein HokC
Synonym(s): Gef, HokC, HokC, Gef toxin; interferes with membrane function when in excess
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 5.502
Isoelectric point: 7.424
Motif(s):
 
Type Positions Sequence
6 -> 47 AMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAY
41 -> 41 V
30 -> 30 C
15 -> 15 C
29 -> 29 L

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0042597 - periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-1564
ECOLIWIKI:
b4412
ECOO157CYC:
GEF-MONOMER
INTERPRO:
IPR018084
INTERPRO:
IPR000021
PFAM:
PF01848
PRIDE:
P0ACG4
PRINTS:
PR00281
PRODB:
PRO_000022915
PRODOM:
PD005979
PROSITE:
PS00556
REFSEQ:
YP_025292
UNIPROT:
P0ACG4


Operon      
Name: mokC-hokC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_39 15463 forward nd [RS-EPT-CBR] [1]
  promoter TSS_40 15553 forward nd [RS-EPT-CBR] [1]
  promoter hokCp4 16951 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_41 16961 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB