RegulonDB RegulonDB 10.7: Gene Form
   

ldrA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

kdsA ldrA rdlA terminator terminator rdlAp5 rdlAp5

Gene      
Name: ldrA    Texpresso search in the literature
Synonym(s): ECK1204, G0-9602, b4419
Genome position(nucleotides): 1269168 <-- 1269275 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.56
External database links:  
ASAP:
ABE-0047280
ECHOBASE:
EB4335
PORTECO:
ldrA
REGULONDB:
b4419
M3D: ldrA
COLOMBOS: ldrA
PortEco: ldrA


Product      
Name: small toxic polypeptide LdrA
Synonym(s): LdrA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 4.014
Isoelectric point: 11.477
Motif(s):
 
Type Positions Sequence
3 -> 32 LAQFAMIFWHDLAAPILAGIITAAIVSWWR
1 -> 35 MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0008219 - cell death
GO:0012501 - programmed cell death
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IE] Inferred from experiment
Reference(s): [1] Kawano M., et al., 2002
[2] Yamaguchi Y., et al., 2014
External database links:  
ECOCYC:
MONOMER0-1601
ECOLIWIKI:
b4419
INTERPRO:
IPR025253
PFAM:
PF13940
PRODB:
PRO_000023077
REFSEQ:
YP_025297
SMR:
P0DPD0
UNIPROT:
P0DPD0


Operon      
Name: ldrA         
Operon arrangement:
Transcription unit        Promoter
ldrA


RNA cis-regulatory element    
Attenuation: Translational


Regulation by small RNA    
  Display Regulation
small RNA rdlA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rdlAp5 1269323 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Kawano M., Oshima T., Kasai H., Mori H., 2002, Molecular characterization of long direct repeat (LDR) sequences expressing a stable mRNA encoding for a 35-amino-acid cell-killing peptide and a cis-encoded small antisense RNA in Escherichia coli., Mol Microbiol 45(2):333-49

 [2] Yamaguchi Y., Tokunaga N., Inouye M., Phadtare S., 2014, Characterization of LdrA (Long Direct Repeat A) Protein of Escherichia coli., J Mol Microbiol Biotechnol 24(2):91-97

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB