RegulonDB RegulonDB 10.7: Gene Form
   

ldrB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ldrB rdlA rdlB terminator terminator rdlBp4 rdlBp4 ldrAp8 ldrAp8 rdlAp5 rdlAp5

Gene      
Name: ldrB    Texpresso search in the literature
Synonym(s): ECK1206, G0-9605, b4421
Genome position(nucleotides): 1269703 <-- 1269810 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.33
External database links:  
ASAP:
ABE-0047281
ECHOBASE:
EB4336
PORTECO:
ldrB
REGULONDB:
b4421
M3D: ldrB
COLOMBOS: ldrB
PortEco: ldrB


Product      
Name: small toxic polypeptide LdrB
Synonym(s): LdrB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 3.972
Isoelectric point: 11.477
Motif(s):
 
Type Positions Sequence
1 -> 35 MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
6 -> 32 FAMTFWHDLAAPILAGIITAAIVGWWR

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0012501 - programmed cell death
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Kawano M., et al., 2002
External database links:  
ECOCYC:
MONOMER0-1602
ECOLIWIKI:
b4421
INTERPRO:
IPR025253
PFAM:
PF13940
PRIDE:
Q6BF87
PRODB:
PRO_000023076
PROTEINMODELPORTAL:
Q6BF87
REFSEQ:
YP_025298
SMR:
Q6BF87
UNIPROT:
Q6BF87


Operon      
Name: ldrB         
Operon arrangement:
Transcription unit        Promoter
ldrB


RNA cis-regulatory element    
Attenuation: Translational


Regulation by small RNA    
  Display Regulation
small RNA rdlB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rdlAp5 1269323 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ldrAp8 1269477 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter rdlBp4 1269856 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Kawano M., Oshima T., Kasai H., Mori H., 2002, Molecular characterization of long direct repeat (LDR) sequences expressing a stable mRNA encoding for a 35-amino-acid cell-killing peptide and a cis-encoded small antisense RNA in Escherichia coli., Mol Microbiol 45(2):333-49

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB