RegulonDB RegulonDB 10.7: Gene Form
   

ldrC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ldrC rdlC rdlB terminator terminator rdlCp3 rdlCp3 ldrBp5 ldrBp5

Gene      
Name: ldrC    Texpresso search in the literature
Synonym(s): ECK1208, G0-9607, b4423
Genome position(nucleotides): 1270238 <-- 1270345 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.56
External database links:  
ASAP:
ABE-0047282
ECHOBASE:
EB4337
PORTECO:
ldrC
REGULONDB:
b4423
M3D: ldrC
COLOMBOS: ldrC
PortEco: ldrC


Product      
Name: small toxic polypeptide LdrC
Synonym(s): LdrC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 4.014
Isoelectric point: 11.477
Motif(s):
 
Type Positions Sequence
1 -> 35 MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0012501 - programmed cell death
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Kawano M., et al., 2002
External database links:  
ECOCYC:
MONOMER0-1603
ECOLIWIKI:
b4423
INTERPRO:
IPR025253
PFAM:
PF13940
REFSEQ:
YP_025299
SMR:
P0DPD1
UNIPROT:
P0DPD1


Operon      
Name: ldrC         
Operon arrangement:
Transcription unit        Promoter
ldrC


RNA cis-regulatory element    
Attenuation: Translational


Regulation by small RNA    
  Display Regulation
small RNA rdlC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ldrBp5 1270012 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter rdlCp3 1270391 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Kawano M., Oshima T., Kasai H., Mori H., 2002, Molecular characterization of long direct repeat (LDR) sequences expressing a stable mRNA encoding for a 35-amino-acid cell-killing peptide and a cis-encoded small antisense RNA in Escherichia coli., Mol Microbiol 45(2):333-49

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB