RegulonDB RegulonDB 10.8: Gene Form
   

gnsA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yccM ymcE ymcF gnsA Cis-reg; thermoregulator gnsAp gnsAp gnsAp2 gnsAp2 ymcEp3 ymcEp3

Gene      
Name: gnsA    Texpresso search in the literature
Synonym(s): ECK0982, G0-9662, b4517, sfa, yccL
Genome position(nucleotides): 1052067 --> 1052240 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
39.66
External database links:  
ASAP:
ABE-0285038
ECHOBASE:
EB3022
PortEco:
gnsA
STRING:
511145.b4517
COLOMBOS: gnsA


Product      
Name: putative phosphatidylethanolamine synthesis regulator GnsA
Synonym(s): GnsA, Sfa, YccL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 6.576
Isoelectric point: 5.08
Motif(s):
 
Type Positions Sequence
1 -> 54 MNIEELKKQAETEIADFIAQKIAELNKNTGKEVSEIRFTAREKMTGLESYDVKI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.1 - phospholipid
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
External database links:  
ECOCYC:
MONOMER0-1701
ECOLIWIKI:
b4517
INTERPRO:
IPR012563
PDB:
4XO1
PDB:
4XO2
PFAM:
PF08178
PRIDE:
P0AC92
PRODB:
PRO_000022823
REFSEQ:
YP_588446
SMR:
P0AC92
UNIPROT:
P0AC92


Operon      
Name: ymcE-gnsA         
Operon arrangement:
Transcription unit        Promoter
gnsA
gnsA
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ymcEp3 1051830 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB