RegulonDB RegulonDB 10.7: Gene Form
   

sapC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sapA sapD sapB sapC sapF TSS_1738 TSS_1738 TSS_1737 TSS_1737 TSS_1736 TSS_1736 TSS_1735 TSS_1735 sapFp5 sapFp5 ycjDp5 ycjDp5 ycjDp4 ycjDp4

Gene      
Name: sapC    Texpresso search in the literature
Synonym(s): ECK1287, G2000, b1292
Genome position(nucleotides): 1353628 <-- 1354518 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.9
External database links:  
ASAP:
ABE-0004348
ECHOBASE:
EB4157
OU-MICROARRAY:
b1292
PORTECO:
sapC
REGULONDB:
b1292
STRING:
511145.b1292
M3D: sapC
COLOMBOS: sapC
PortEco: b1292


Product      
Name: putrescine ABC exporter membrane protein SapC
Synonym(s): SapC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 31.548
Isoelectric point: 4.978
Motif(s):
 
Type Positions Sequence
29 -> 49 AMVGLYGCAGLAVLCIFGGWF
113 -> 292 GLVLGTFAGATHGLRSAVLNHILDTLLAIPSLLLAIIVVAFAGPSLSHAMFAVWLALLPRMVRSIYSMVHDELEKEYVIAARLDGASTLNILWFAVMPNITAGLVTEITRALSMAILDIAALGFLDLGAQLPSPEWGAMLGDALELIYVAPWTVMLPGAAIMISVLLVNLLGDGVRRAII
197 -> 217 GASTLNILWFAVMPNITAGLV
223 -> 243 ALSMAILDIAALGFLDLGAQL
16 -> 66 LRTAWRKFYSDASAMVGLYGCAGLAVLCIFGGWFAPYGIDQQFLGYQLLPP

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0015489 - putrescine transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
GO:0015847 - putrescine transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10824N
ECOCYC:
SAPC-MONOMER
ECOLIWIKI:
b1292
INTERPRO:
IPR025966
INTERPRO:
IPR000515
INTERPRO:
IPR035906
MINT:
MINT-1289680
PFAM:
PF12911
PFAM:
PF00528
PRIDE:
P0AGH5
PRODB:
PRO_000023906
PROSITE:
PS50928
PROTEINMODELPORTAL:
P0AGH5
REFSEQ:
NP_415808
SMR:
P0AGH5
UNIPROT:
P0AGH5


Operon      
Name: sapABCDF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ycjDp4 1351866 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ycjDp5 1351896 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter sapFp5 1352657 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1735 1353593 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1736 1353743 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1737 1355493 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1738 1356037 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB