RegulonDB RegulonDB 10.7: Gene Form
   

sapA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sapA sapB sapC ymjA TSS_1738 TSS_1738 TSS_1737 TSS_1737 TSS_1736 TSS_1736

Gene      
Name: sapA    Texpresso search in the literature
Synonym(s): ECK1289, G2002, b1294
Genome position(nucleotides): 1355467 <-- 1357110 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.26
External database links:  
ASAP:
ABE-0004354
ECHOBASE:
EB4155
OU-MICROARRAY:
b1294
PORTECO:
sapA
REGULONDB:
b1294
STRING:
511145.b1294
M3D: sapA
COLOMBOS: sapA
PortEco: b1294


Product      
Name: putative periplasmic binding protein SapA
Synonym(s): SapA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 61.565
Isoelectric point: 7.351
Motif(s):
 
Type Positions Sequence
1 -> 21 MRQVLSSLLVIAGLVSGQAIA
22 -> 547 APESPPHADIRDSGFVYCVSGQVNTFNPSKASSGLIVDTLAAQFYDRLLDVDPYTYRLMPELAESWEVLDNGATYRFHLRRDVPFQKTDWFTPTRKMNADDVVFTFQRIFDRNNPWHNVNGSNFPYFDSLQFADNVKSVRKLDNHTVEFRLAQPDASFLWHLATHYASVMSAEYARKLEKEDRQEQLDRQPVGTGPYQLSEYRAGQFIRLQRHDDFWRGKPLMPQVVVDLGSGGTGRLSKLLTGECDVLAWPAASQLSILRDDPRLRLTLRPGMNVAYLAFNTAKPPLNNPAVRHALALAINNQRLMQSIYYGTAETAASILPRASWAYDNEAKITEYNPAKSREQLKSLGLENLTLKLWVPTRSQAWNPSPLKTAELIQADMAQVGVKVVIVPVEGRFQEARLMDMSHDLTLSGWATDSNDPDSFFRPLLSCAAIHSQTNLAHWCDPKFDSVLRKALSSQQLAARIEAYDEAQSILAQELPILPLASSLRLQAYRYDIKGLVLSPFGNASFAGVYREKQDEVKKP
34 -> 35 SG
79 -> 457 LMPELAESWEVLDNGATYRFHLRRDVPFQKTDWFTPTRKMNADDVVFTFQRIFDRNNPWHNVNGSNFPYFDSLQFADNVKSVRKLDNHTVEFRLAQPDASFLWHLATHYASVMSAEYARKLEKEDRQEQLDRQPVGTGPYQLSEYRAGQFIRLQRHDDFWRGKPLMPQVVVDLGSGGTGRLSKLLTGECDVLAWPAASQLSILRDDPRLRLTLRPGMNVAYLAFNTAKPPLNNPAVRHALALAINNQRLMQSIYYGTAETAASILPRASWAYDNEAKITEYNPAKSREQLKSLGLENLTLKLWVPTRSQAWNPSPLKTAELIQADMAQVGVKVVIVPVEGRFQEARLMDMSHDLTLSGWATDSNDPDSFFRPLLSCAAI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:1904680 - peptide transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
GO:0042886 - amide transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
DIP:
DIP-10822N
ECOCYC:
SAPA-MONOMER
ECOLIWIKI:
b1294
INTERPRO:
IPR030678
INTERPRO:
IPR039424
INTERPRO:
IPR000914
INTERPRO:
IPR023765
MINT:
MINT-1292044
MODBASE:
Q47622
PANTHER:
PTHR30290
PFAM:
PF00496
PRIDE:
Q47622
PRODB:
PRO_000023904
PROSITE:
PS01040
PROTEINMODELPORTAL:
Q47622
REFSEQ:
NP_415810
SMR:
Q47622
UNIPROT:
Q47622


Operon      
Name: sapABCDF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1736 1353743 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1737 1355493 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1738 1356037 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB