RegulonDB RegulonDB 10.8: Gene Form
   

flgA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

flgA flgB flgM FlhDC FlhDC FlhDC CsgD CsgD flgBp flgBp flgAp flgAp TSS_1343 TSS_1343 flgMp flgMp TSS_1342 TSS_1342 flgNp1 flgNp1

Gene      
Name: flgA    Texpresso search in the literature
Synonym(s): ECK1057, G357, b1072, flaU
Genome position(nucleotides): 1130204 <-- 1130863 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.27
External database links:  
ASAP:
ABE-0003637
CGSC:
756
ECHOBASE:
EB4160
OU-MICROARRAY:
b1072
PortEco:
flgA
STRING:
511145.b1072
COLOMBOS: flgA


Product      
Name: flagellar basal body P-ring formation protein FlgA
Synonym(s): FlaU, FlgA
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 23.519
Isoelectric point: 10.804
Motif(s):
 
Type Positions Sequence
1 -> 21 MLIIKRSVAIIAILFSPLSTA
96 -> 215 NYVVAAMPIARGGKLEAGNVKLKRGRLDTLPPRTVLDINQLVDAISLRDLSPDQPIQLTQFRQAWRVKAGQRVNVIASGDGFSANAEGQALNNAAVAQNARVRMVSGQVVSGVVDADGNI
22 -> 219 SNLTSQLHNFFSAQLAGVSDEVRVSIRTAPNLLPPCEQPLLSMSNNSRLWGNVNVLARCGNDKRYLQVNVQATGNYVVAAMPIARGGKLEAGNVKLKRGRLDTLPPRTVLDINQLVDAISLRDLSPDQPIQLTQFRQAWRVKAGQRVNVIASGDGFSANAEGQALNNAAVAQNARVRMVSGQVVSGVVDADGNILINL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
biological_process GO:0071973 - bacterial-type flagellum-dependent cell motility
GO:0044780 - bacterial-type flagellum assembly
GO:0044781 - bacterial-type flagellum organization
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Juhas M., et al., 2015
[2] Ohnishi K., et al., 1987
External database links:  
ECOCYC:
G357-MONOMER
ECOLIWIKI:
b1072
INTERPRO:
IPR013974
INTERPRO:
IPR039246
INTERPRO:
IPR017585
PANTHER:
PTHR36307
PFAM:
PF13144
PRIDE:
P75933
PRODB:
PRO_000022637
REFSEQ:
NP_415590
SMART:
SM00858
SMR:
P75933
UNIPROT:
P75933


Operon      
Name: flgAMN         
Operon arrangement:
Transcription unit        Promoter
flgMN
flgAMN


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter flgNp1 1129914 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_1342 1130164 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1343 1130193 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Juhas M., Ajioka JW., 2015, Identification and Validation of Novel Chromosomal Integration and Expression Loci in Escherichia coli Flagellar Region 1., PLoS One 10(3):e0123007

 [2] Ohnishi K., Homma M., Kutsukake K., Iino T., 1987, Formation of flagella lacking outer rings by flaM, flaU, and flaY mutants of Escherichia coli., J Bacteriol 169(4):1485-8

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB