RegulonDB RegulonDB 10.8: Gene Form
   

flgC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

flgD flgB flgC TSS_1345 TSS_1345 TSS_1344 TSS_1344

Gene      
Name: flgC    Texpresso search in the literature
Synonym(s): ECK1059, G359, b1074, flaW
Genome position(nucleotides): 1131438 --> 1131842 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.84
External database links:  
ASAP:
ABE-0003643
CGSC:
754
ECHOBASE:
EB4015
OU-MICROARRAY:
b1074
PortEco:
flgC
STRING:
511145.b1074
COLOMBOS: flgC


Product      
Name: flagellar basal-body rod protein FlgC
Synonym(s): FlaW, FlgC
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,cell projection
Molecular weight: 13.968
Isoelectric point: 5.003
Motif(s):
 
Type Positions Sequence
7 -> 37 FDIAGSALTAQSQRLNVAASNLANADSVTGP
87 -> 131 AKGYVKMPNVDVVGEMVNTMSASRSYQANVEVLNTVKSMMLKTLT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0009288 - bacterial-type flagellum
GO:0009424 - bacterial-type flagellum hook
GO:0009425 - bacterial-type flagellum basal body
GO:0030694 - bacterial-type flagellum basal body, rod
biological_process GO:0071973 - bacterial-type flagellum-dependent cell motility
GO:0071978 - bacterial-type flagellum-dependent swarming motility
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Suzuki T., et al., 1981
External database links:  
ECOCYC:
FLGC-FLAGELLAR-MOTOR-ROD-PROTEIN
ECOLIWIKI:
b1074
INTERPRO:
IPR010930
INTERPRO:
IPR019776
INTERPRO:
IPR006299
INTERPRO:
IPR001444
PANTHER:
PTHR30435:SF2
PFAM:
PF00460
PFAM:
PF06429
PRIDE:
P0ABX2
PRODB:
PRO_000022639
PROSITE:
PS00588
REFSEQ:
NP_415592
SMR:
P0ABX2
UNIPROT:
P0ABX2


Operon      
Name: flgBCDEFGHIJ         
Operon arrangement:
Transcription unit        Promoter
flgBCDEFGHIJ


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1344 1131956 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1345 1132384 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Suzuki T., Komeda Y., 1981, Incomplete flagellar structures in Escherichia coli mutants., J Bacteriol 145(2):1036-41

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB